SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009061202.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009061202.1.39240
Domain Number 1 Region: 69-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000355
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  XP_009061202.1.39240
Domain Number - Region: 41-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.062
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009061202.1.39240
Sequence length 234
Comment hypothetical protein LOTGIDRAFT_234725 [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
MLSIRVLGLFAVIAIALVLVESEFSEVCYGELPANAMCSVENNKTRRCQCKEGYEMDIIC
TSNGSIFSCQDIDECATNNGSCEFKCQNEPGSYNCSCPEGSELQENGLNCEPIKPGPCMF
ENQTVTGVSQNFNRTYIGNENETECEKKCNTTVGCTDWLILDGHCQNFGLPIIQVELIPD
GSPEKCKDLCAQNKKCVTAQYFVTCTLFDTKQTEFDDGCDPETVFHKIDMNCLN
Download sequence
Identical sequences V3ZUY1
XP_009061202.1.39240 jgi|Lotgi1|234725|estExt_fgenesh2_pg.C_sca_540097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]