SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009061946.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_009061946.1.39240
Domain Number - Region: 47-163
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000408
Family Growth factor receptor domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009061946.1.39240
Sequence length 207
Comment hypothetical protein LOTGIDRAFT_175958, partial [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
MTVQWVSKPGYKEDDCTRVCATGTYGSECNNFCHCLNYDKCDVITGQCPNGCQTEWYGGN
CNTSCQSGKYGDRCSKLCNNRHCKRSQECHHITGQCTDGCKPGYKGYDCTLSCPNGAYGD
KCSKLCNNRHCKGSQECHHITGQCTDGCKPGYRRNDCIKKCQKRAYGDICSKGCDNRQCK
GSQHCPHITGKCYNGCTPGYREDDCTV
Download sequence
Identical sequences V3ZXP5
XP_009061946.1.39240 jgi|Lotgi1|175958|fgenesh2_pg.C_sca_591000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]