SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009063629.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009063629.1.39240
Domain Number 1 Region: 106-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009063629.1.39240
Sequence length 244
Comment hypothetical protein LOTGIDRAFT_154876 [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
MVNTSTFFQHFKQSRFEYDDYHIGVNRASYGNPPSYCFTSNVTFVISYKMSLTCRIELAV
TIAVVIVSCVCGMKIDFTRLSHHKRSYYIPQKRGSECSGNPCPVDKPFLCKTSSTCIALK
YVCDNTFDCEDGFDEEKALCTAVSRPPIEQLFNFLTAEQDWIIPKLFGGVEPEFAAHGLA
VASDIDDLSMTLGLSPQNVKNLHKAFQAAMEGDERPLLAMNMPERSWHEVQYMLQQLLDS
GFKL
Download sequence
Identical sequences V3ZWS4
jgi|Lotgi1|154876|fgenesh2_pg.C_sca_7000025 XP_009063629.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]