SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009063910.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009063910.1.39240
Domain Number 1 Region: 48-88
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000263
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  XP_009063910.1.39240
Domain Number - Region: 4-55
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000285
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009063910.1.39240
Sequence length 96
Comment hypothetical protein LOTGIDRAFT_107831, partial [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
CNDNVDECSASDKNDCASNTDCKDTDGSFIYGTCTCKDGWAGATCNDNVDECQQTTTCNS
VPNSKCEDLQGSFNCKCNAGYVKVNDKCEGRLYFRS
Download sequence
Identical sequences V3ZMY0
XP_009063910.1.39240 jgi|Lotgi1|107831|e_gw1.7.53.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]