SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009064583.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009064583.1.39240
Domain Number 1 Region: 26-109
Classification Level Classification E-value
Superfamily Prefoldin 0.00000000183
Family Prefoldin 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009064583.1.39240
Sequence length 132
Comment hypothetical protein LOTGIDRAFT_196436 [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
MASVKKETDRLIDHLSVIEEAAEDILSDKQQIIEFDLRRNKTREALRSLQKSNKEKKSWI
CIGGMFIKMPKKTAVKMLEKDYDELEKEINETRTKLKPKVNKLRDLQNEDDIKGFGLEPL
SQSEVRAVERLL
Download sequence
Identical sequences V3ZKH2
jgi|Lotgi1|196436|estExt_Genewise1.C_sca_750129 XP_009064583.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]