SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009064798.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_009064798.1.39240
Domain Number - Region: 74-107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.012
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009064798.1.39240
Sequence length 139
Comment hypothetical protein LOTGIDRAFT_236238 [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
MNNLSCSVLLISVILILVDADCSTYPNVTDANFEKDCDGNVIISCNKDFKMVQGLECVEE
EWRYQNPICKRTEIVNPCKNNGTVLSDGSCNCTEYFGGTFCEEMRCEMLEYQDCKSECKR
GQDEMNEYCDDGLFCCYYG
Download sequence
Identical sequences V3ZQ18
jgi|Lotgi1|236238|estExt_fgenesh2_pg.C_sca_770084 XP_009064798.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]