SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009065133.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009065133.1.39240
Domain Number 1 Region: 362-404
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000596
Family Ovomucoid domain III-like 0.0053
Further Details:      
 
Domain Number 2 Region: 286-328
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000061
Family Ovomucoid domain III-like 0.0053
Further Details:      
 
Domain Number 3 Region: 400-442
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000061
Family Ovomucoid domain III-like 0.0053
Further Details:      
 
Domain Number 4 Region: 478-518
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000061
Family Ovomucoid domain III-like 0.0036
Further Details:      
 
Domain Number 5 Region: 325-366
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000721
Family Ovomucoid domain III-like 0.0053
Further Details:      
 
Domain Number 6 Region: 252-290
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000818
Family Ovomucoid domain III-like 0.0053
Further Details:      
 
Domain Number 7 Region: 442-480
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000139
Family Ovomucoid domain III-like 0.0055
Further Details:      
 
Domain Number 8 Region: 514-558
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000568
Family Ovomucoid domain III-like 0.007
Further Details:      
 
Domain Number 9 Region: 10-55
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000152
Family Ovomucoid domain III-like 0.0053
Further Details:      
 
Domain Number 10 Region: 215-252
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000079
Family Ovomucoid domain III-like 0.0085
Further Details:      
 
Domain Number 11 Region: 563-601
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000104
Family Ovomucoid domain III-like 0.0037
Further Details:      
 
Domain Number 12 Region: 54-95
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000194
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 13 Region: 137-175
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000374
Family Ovomucoid domain III-like 0.0046
Further Details:      
 
Domain Number 14 Region: 98-136
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000804
Family Ovomucoid domain III-like 0.0056
Further Details:      
 
Domain Number 15 Region: 176-214
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000236
Family Ovomucoid domain III-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009065133.1.39240
Sequence length 640
Comment hypothetical protein LOTGIDRAFT_210962 [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
MKGLIFVLVFSSVGANPLCPCPLNYEPVCGVDGKTYNNECHQQCVGVAKKSDGKCPPVCA
CQLIDEPVCGVDGKTYSNQCELDCVGVTKRSDGKCPPVCACQLIDEPVCGVDGKSYSNQC
ELDCVGVTKRSDGECPVCACQLIDEPVCGVDGKTYSNQCELDCFGVTKRSDGECPVCACQ
LIDEPVCGVDGKSYSNQCELDCVGVTKRSDGECPVCACQLIDEPVCGVDGKTYSNQCELD
CVQVTKKSDGKCPCACPRNYEPVCGEDGVTYSNECELNCGQVTKKSDGKCPCACPRNYEP
VCGEDGVTYSNECELNCGQVTKKSDGKCPCACPRNYEPVCGEDGVTYSNECELNCGQVTK
KSDGKCPCACPRNYEPVCGEDGVTYSNECELNCGQVTKKSDGKCPCACPRNYEPVCGEDG
VTYSNECELNCGQVTKKSDGKCPCACPRNYEPVCGEDGVTYSNECELNCGQVTKKSEGKC
PCACPRNYEPVCGEDGVTYSNECELNCGEVLLRHSGKCEKICSCTKIYDPVCGADGITYS
NLCLLNCQDVNWAYNGECFDPCAICPNIYKPVCGSSLLTYPNECFMACKKVKKLFDGSCP
KLTPHGNDGIHNNQGNRNNFNTDNSIGNYVGGRGQRGFPI
Download sequence
Identical sequences V3ZNF7
XP_009065133.1.39240 jgi|Lotgi1|210962|estExt_Genewise1Plus.C_sca_80161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]