SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009066206.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009066206.1.39240
Domain Number 1 Region: 57-138
Classification Level Classification E-value
Superfamily F-box domain 3.01e-17
Family F-box domain 0.0017
Further Details:      
 
Weak hits

Sequence:  XP_009066206.1.39240
Domain Number - Region: 288-312
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00859
Family Ovomucoid domain III-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009066206.1.39240
Sequence length 508
Comment hypothetical protein LOTGIDRAFT_236816 [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
MAVNHQKVVANYLNKHKVTEKQISNSQPTSKDKQGIYADKSRKPRFIKRKPPPVIHGKAN
ISHLPDELLLELFEYLDAASLLTSACVCKKWQEITNDNSLWITIYKNYAKFKGRPVIPTG
KLPLSYWKDLCLKRCSEERNKNVQKMMKRIHLYTGLPENTVKCLKKCGITYQLTTLDNHG
VERSYRSSDIFYHTMSVSIRWYNLQGLAIKSLRKLKILSCNPLFFNSQGVVIPNSPYQRS
LLTEVSIKWENWKKENKPIKEDENIQLYKISNDILLATWKADGELAFIVCGFHHNNFINR
CLLGSYKCQYEPKEHKVISDDIDPNYGLHHYKCTVELRNIRQSIWNQQFQGLECKQNNIV
NNICALILRRSNDVTDRLPVDKQIQLPWKTELFKGIVKDVCWLDVTLLDERGEVFWSLSS
PVYTMSKETTKNVAMDFEYKDESKLEMTIKTVDVEVLIQLNEMDDGTRFITHLELQLDIS
LVDTWFGTSYRIPGKQVTEKQTENTISY
Download sequence
Identical sequences V3YY28
XP_009066206.1.39240 jgi|Lotgi1|236816|estExt_fgenesh2_pg.C_sca_880001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]