SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009066700.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_009066700.1.39240
Domain Number - Region: 142-216
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0408
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 42-116
Classification Level Classification E-value
Superfamily Prefoldin 0.0811
Family Prefoldin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009066700.1.39240
Sequence length 345
Comment hypothetical protein LOTGIDRAFT_109065 [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
MKIAYSISLICLHEFDFTFQYQVCRCKLDSKCEALLILSKELDQCRSERDQFKLMAEQLR
ERYQAIKRQMTGRSLVQLLCDTKEVKKSLKFEVDDLKQKLNDAQGDIKLLREQIARQRVG
STDEGMTTRHFPAYEREDLVKQLEASREQYLQLEHDLQQLLDEKEDQETELDAYKSKYEN
LNRELNYILKGDEKRIVDIDALVAENKFLNERLKQMEEEKSMAMATASKYKSILERRKNK
GILKFGQSRSGGLVITQKQVGQMLHNPTGMPSTPQAMADLQGLCGALLDTINDKNLALSH
QRKTNKLLGSRVSELEKKLKTLEVAGLWNVPGMILFICSCKSYCP
Download sequence
Identical sequences V3ZFP4
jgi|Lotgi1|109065|e_gw1.9.243.1 XP_009066700.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]