SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009066793.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009066793.1.39240
Domain Number 1 Region: 23-52
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000245
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 2 Region: 5-27
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000125
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009066793.1.39240
Sequence length 52
Comment hypothetical protein LOTGIDRAFT_61096, partial [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
EITESDYICYCVPGFTGRNCQVNIDECTVNPCQQDGLCIDGINNYFCACMKG
Download sequence
Identical sequences V4B2E5
XP_009066793.1.39240 jgi|Lotgi1|61096|gw1.9015.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]