SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009067132.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009067132.1.39240
Domain Number 1 Region: 103-132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000871
Family EGF-type module 0.056
Further Details:      
 
Weak hits

Sequence:  XP_009067132.1.39240
Domain Number - Region: 41-77
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0471
Family Pan module (APPLE domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009067132.1.39240
Sequence length 144
Comment hypothetical protein LOTGIDRAFT_170260 [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
MKLFFGIVLMNLGLVAVDCGQRFWRMKECDHKRFQLGDTPELKSKTKYHCVKMCQDEAEC
LTIFFDGTHGRCYKFDKLPKSTCHNLVEYYSGKNHEFLYKGIQCKNGGTASEDKLNCQCV
NDWSGRFCEIPKDSNEEDEKEDAY
Download sequence
Identical sequences V3ZDU1
jgi|Lotgi1|170260|fgenesh2_pg.C_sca_95000056 XP_009067132.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]