SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009102019.1.100322 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009102019.1.100322
Domain Number 1 Region: 274-453
Classification Level Classification E-value
Superfamily NTF2-like 3.86e-49
Family TIM44-like 0.00049
Further Details:      
 
Weak hits

Sequence:  XP_009102019.1.100322
Domain Number - Region: 64-135
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00144
Family Apolipoprotein A-I 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009102019.1.100322
Sequence length 462
Comment PREDICTED: mitochondrial import inner membrane translocase subunit TIM44-2-like [Brassica rapa]; AA=GCF_000309985.1; RF=representative genome; TAX=3711; STAX=3711; NAME=Brassica rapa; cultivar=Chiifu-401-42; AL=Chromosome; RT=Major
Sequence
MASRKLIRDLLITRQPLFLRLAHQRRAGERLGGFMPAIGCSINRRFSIFSDFSKKIRGEA
ESNPEFQKTVKELKEKAEELKGVKEDLKVKTKEKTEQLYKQVDGVWTEAESVAKKVSSSV
KDTFSAATEEVKESFKLGKEENAESASSSGTGNSKEENHQQQQQSGTTEGGQHTLFEKIK
SSISSPLDIARKGIDIVKDELRGGTPKKKHLEYTPPPPFTGVKSTRTDLVVTPTKQSKWQ
KKWESLREKMQAHPAFKRLSGISEPVVNKSQEIAEDVVERWETSDNPIVHKIQDLNEAVF
NETDSGSTYKEIRRRDPSFSLTDFAAEVHEAIKPVLSAYSKGDAETLKKYCSPEVIERCT
AELAALKGHDLFFDHKILHISEVEVEETKMMGTIPTIIVRFQTQEIFCVRDKKGNIKEGG
QDTIHSVYYKWAMQQVEAGEESMYPIWRLRDICKLGAAQALI
Download sequence
Identical sequences M4F5X2
Bra036478 XP_009102019.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]