SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009111127.1.100322 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009111127.1.100322
Domain Number 1 Region: 315-611
Classification Level Classification E-value
Superfamily TPR-like 2.8e-38
Family HAT/Suf repeat 0.028
Further Details:      
 
Domain Number 2 Region: 85-254
Classification Level Classification E-value
Superfamily TPR-like 4.36e-34
Family HAT/Suf repeat 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009111127.1.100322
Sequence length 748
Comment PREDICTED: pre-mRNA-processing factor 39-like isoform X1 [Brassica rapa]; AA=GCF_000309985.1; RF=representative genome; TAX=3711; STAX=3711; NAME=Brassica rapa; cultivar=Chiifu-401-42; AL=Chromosome; RT=Major
Sequence
MGESQAMVAEGYNASAATVESNVDSSQSVANVSLVNGTGPEGGSTASAENGTATDNVPVT
APGAGHIDNAGSALSPEEERLWSIVRANSSEFNAWTALIEETERISQDNISKIRKVYDAF
LAEFPLCYGYWKKYADHEARVGAMDKVVEVYERAVQGVTYSVDIWLHYCVFAINTYGDPD
TIRSLFERAVVYVGTDFLSSPLWDKYIEYEHMQQDWSRLAMIYTRILENPIQNLDRYFNN
FKELAETRPLSELRSAEESATVAVASDASETALSESDGKADEGKSQADGTSEPSKLESAG
STDPEELKKYIGIREALYIKAKEFESKIIGFEMAIRRPYFHVRPLNVAELENWHNYLDFI
ESDGDFNKVVKLYERCLVACANYPEYWIRYVLSMGSSGSMDLADNALTRATQVFVKRQPE
IHLFAARLKEQNGDIAGARAAFQLLHSEISPGLLEAVIKHANMEQRLGNVDDAFSVYEQV
IAVEKGKDNSILLPLLYAQYSRFSYLVLRDAEKARKIIVEALDHVQPSKHFMEALIFFET
ILPPPRKIEYLDPLVENLIKPNVDTQNTASSTEREELSLIYIEFLGLFGDVESIKKAEDR
HCKLFLPHRSRSELKKRSADEFLSSDRTKLAKTYNETAPAQPVSNAYPNAPAQWSGGYAA
QPQAWPQPQAAPAQPQQWNPAYGQQQAAYGAYGGYPAGYAAPQAPTPVPQAAAYGAYPPQ
AYPATAPLAAPVQQPAAAPPQAYYNTYY
Download sequence
Identical sequences M4EP34
Bra030554 XP_009111127.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]