SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009168829.1.43250 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009168829.1.43250
Domain Number 1 Region: 720-931
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-35
Family DBL homology domain (DH-domain) 0.00051
Further Details:      
 
Domain Number 2 Region: 90-191
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000901
Family BRCT domain 0.088
Further Details:      
 
Domain Number 3 Region: 201-262,318-337
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000369
Family DNA topoisomerase II binding protein 1, TopBP1 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009168829.1.43250
Sequence length 1855
Comment hypothetical protein T265_05531 [Opisthorchis viverrini]; AA=GCF_000715545.1; RF=representative genome; TAX=6198; STAX=6198; NAME=Opisthorchis viverrini; AL=Scaffold; RT=Major
Sequence
MATERSRLTVVGNDAFANDDFSKLIAKLSGRFAIAYLPDIAACLARTRREKEYEPTVSDC
DWFLFSDFTDCTDLHCLVSLLPRARIMGYPAFVTCMLSQEKWVKPRPVFNFSMMGAVVCI
TGYRDRETVNRLATMVNWMGGSVQRSLNVSTTTHLVAYRCAGEKVRAAALAPRRITTVKA
SWIDNAWARRIEQPTLNATDPEFVEAHRAKVFSETCLAFVGFVPGSEELLELCRLVVEHD
GLVTEDLNDQRLTHVVVTDNWPGYGNILERLNDLIVSAGPTKSPVSASRQHSSAIQFAGS
PSLTEEDQYRISLLASAYRVPVVRLKWFWLSLQLTCLCHLENFLYVAGPPRPSSVYRPQL
PPLARPGSITPEAGSLSPPESRSSPLSSPVPMLTPLPDIEERMEEGEETSFSGPTGSRSL
SESDTRAHDEKENALPSEFHSLDSPHTVLGSSPLARRVLSKELFRSSPNRSPLSHHIADK
ISFITSPRNRNSPRGFTSPSADASQHSSGRRSSHPRRSKASLGAISGSSSHDDLLTQLAD
PMTFPSNRERRLCQLVVVGHGNDTKPVSSNGDARLPMSEPGLFYSPASFNSGLLLNATNA
SECNANGSVLVPEPQSHDFISSVGSLRNMLNTEDMVAAEPNCEMTMPTQLKSPLAQPTGE
SAQTSTPASGKRKSSTRLSLLHSTARKSRTPAPEMSATSSSNSSTPAGDSSTGQSGTPLR
VRLEKRQHRVFEFFVTERNYVEVLRYLYRVAYSQVVNEDQSGGAILPRQEADYIFGKLGP
IYELHERLQPKLSQLETNWSLAESCLGDVLRMELLDEMDKAYGNYMQFYSPPHIHRLGEQ
FPRFLAFLRQVERRKESGRQSLTALLVRPVQRLPSIALLLDGISKFTPGSHPDNAGVTQF
AKGLNELLLKINERLRKNEERLSLLSLYHEISGAPPEMLSSSRSLISRLDVFELGTSASG
NTTCEPVTLFLLTDSLEVARPRKRHTGEPLAHAIRAALAVVHGEGGEVCTDSTNRNLNVT
PGVCPSTNASLQSESNAAGVTASAGSDHTVTVTRTGSGASGASIVNFGMVEGKQRCHYKH
LQLLKLQEIKRVVSFDTASPDRAAFGLVVRSSSEMDDRVYAYCLAASFAATTAVATGRCP
EPVESAVAAAASASLTGTLVRTESLGCTTPASSSSHVATLQACVSEAKRKFLNQLCHHII
QVSCLANSPEELLVDVQPEELLGFDLEQVFNATAAAMKSKKFGRQLTRNISIKTPRRPLA
PGKQQRPTGGSVLHTPGSVPQQNHNTDDATSLQHYPISSPRRSVLGSLLGQRGATFTGEH
ASLVTGSSHFVEASTPLRDKRQCSTLRPPSTPTAEQVTMTMLNMMRIARSTVQHSRKELT
HTGSISLFDDDDDDEECTGDYPDDDCASVASGNLGGTFWPIYTKHTGGATRAEAALSSTS
SLRSHTIDLSSVASAMDSVSSLRTVCTTSQPQSHRNSLSRRGPLGRPSVLLSDYDFRGQR
KSVCQTVLAGLKNFRRSIAGAGSALLHGNSTSSFTSSLARHGHRGPNRAGASSLASPGIL
NRSASVDASICNTVLASPSTLASTGDLCMSGLSLNRPAPLAETELEREIEPSTTTASPFP
PARGLLTSSAAATANQYQSPRLEEPRLFVRSATSTAVNSHGQLMMTPSGSFRNIPSVALH
NQSNTQLPLFSRKAPELDTVTLDEVCMAELDTSPCKRLGGSMVSLASWNSVSTLDCPQSS
DNRFHRLQANDGSSAVCETVSHIGVTTREDLRRSFRIPTAVRHLGSSHGGASRREGQKKQ
KKHKMSSIGHLFQRPSVIAKPVGATVVPTSTSNQCPATKVNPSRRESLLRGIFSR
Download sequence
Identical sequences A0A074ZK49
XP_009168829.1.43250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]