SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009230977.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009230977.1.23681
Domain Number 1 Region: 368-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.34e-26
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 620-677
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.87e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 565-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.23e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 677-733
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 453-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.26e-24
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 6 Region: 718-770
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.76e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 508-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.63e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 8 Region: 313-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-20
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 9 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 10 Region: 415-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000105
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 11 Region: 246-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000133
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  XP_009230977.1.23681
Domain Number - Region: 215-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000268
Family Classic zinc finger, C2H2 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009230977.1.23681
Sequence length 800
Comment PREDICTED: zinc finger protein 226 isoform X1 [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MNMFKEAVTFKDVAVAFTEEELGLLGPAQRKLYRDVMVENFRNLLSVGHQPFKQDVSPIE
RNEQLWIVTTATRRQRNLGEKNQSKLITVQDRESEEELSCWQIWQQIANDLTRCQDSMIN
NYQFHKQGDFPCQVGTELSIQISEDENYLVNKADGPNNTGNPEFPILRTQDSWRKTFLTE
SQRLNRDQQISIKNKLCQCKKGVNPIGWISHHDGHRVHKSEKSYRPNDYKKDNTKILTFD
QNSMIHTGQKSYQCNECKKPFGDLSSFDLHQQLQSGEKSLTCVERGKGFCYSSVLPVHQK
VNVGEKLKCDKEFSQGAHLQTHQKVHVIEKPYKCKQCGKGFSRRSALNVHCKVHTGEKPY
NCEECGRAFSQASHLQDHQRLHTGEKPFKCDACGKSFSRNSHLQSHQRVHTGEKPYKCEE
CGKGFICSSNLYIHQRVHTGEKPYKCEECGKGFSRPSSLQAHQGVHTGEKSYICTVCGKG
FTLSSNLQAHQRVHTGEKPYKCNACGKSFRRNSHYQVHLVVHTGEKPYKCEICGKGFSQS
SYLQIHQKAHSIEKPFKCEECGQGFNQSSRLQIHQLIHTGEKPYKCEECGKGFSRRADLK
IHCRIHTGEKPYNCEECGKVFRQASNLLAHQRVHSGEKPFKCEECGKSFGRSAHLQAHQK
VHTGDKPYKCDECGKGFKWSLNLDMHQRVHTGEKPYKCGECDKYFSQASSLQLHQSVHTG
EKPYKCDVCGKVFSRSSQLQSHQRVHTGEKPYKCEICGKSFSWRSNLTIHHRIHVGDKSY
KNNRGGKNIRESTQEKKSIK
Download sequence
Identical sequences H2NZ47
ENSPPYP00000011281 ENSPPYP00000011281 XP_009230975.1.23681 XP_009230976.1.23681 XP_009230977.1.23681 XP_009230978.1.23681 9600.ENSPPYP00000011281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]