SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009231531.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009231531.1.23681
Domain Number 1 Region: 267-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 351-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 436-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 212-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.78e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 482-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 314-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000983
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 7 Region: 398-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000178
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 8 Region: 175-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000287
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Weak hits

Sequence:  XP_009231531.1.23681
Domain Number - Region: 123-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0283
Family Classic zinc finger, C2H2 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009231531.1.23681
Sequence length 541
Comment PREDICTED: zinc finger protein 329 [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MRLKMTTWNFPEREVPCDVEVERFTREIPCLSSLGDGWDCENQEGHLRQSALTLEKPGTQ
EAICEYPGFGEHLIASSDLPPSQRVLATNGFHAPDSNVSGLDYDPALPSYPKSYAGKRTG
DSDACGKGFNHSMEVIHGRNPVREKPYKYPESVKSFNHFTSLGHQKIMKRGKKSYEGKDF
EDIFTLSSSLNENQRNLPGEKQYRCTECGKCFKRNSSLVLHHRTHTGEKPYTCNECGKSF
SKNYNLIVHQRIHTGEKPYECSKCGKAFSDGSALTQHQRIHTGEKPYECLECGKTFNRNS
SLILHQRTHTGEKPYRCNECGKPFTDISHLTVHLRIHTGEKPYECSKCGKSFRDGSYLTQ
HERTHTGEKPFECAECGKSFNRNSHLIVHQKIHSGEKPYECKECGKTFIESAYLIRHQRI
HTGEKPYGCNQCQKLFRNIAGLIRHQRTHTGEKPYECNQCGKAFRDSSCLTKHQRIHTKE
TPYQCPECGKSFKQNSHLAVHQRLHSREGPSQCPQCGKTFQKSSSLVRHQRAHLGEQPME
T
Download sequence
Identical sequences H2P0F9
ENSPPYP00000011759 XP_009231529.1.23681 XP_009231530.1.23681 XP_009231531.1.23681 9600.ENSPPYP00000011759 ENSPPYP00000011759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]