SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009233561.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009233561.1.23681
Domain Number 1 Region: 42-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.66e-34
Family SCAN domain 0.000079
Further Details:      
 
Domain Number 2 Region: 402-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.6e-22
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 360-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 443-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.27e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 233-278
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.15e-17
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009233561.1.23681
Sequence length 510
Comment PREDICTED: zinc finger protein 75D [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MTMRELNADSCSSPQMGAMWETSGSVKENSSQSKKYSTKIENLGPESACRHFWSFRYHEA
TGPLETISQLQKLCHQWLRPEIHSKEQILEMLVLEQFLSILPKETQNWVQKHHPQNVKQA
LVLVEFLQREPDGTKNEVTAHELGKEAVLLGGTAVAPGFKWKPAEPQPMGVFQKEYWNTY
RVLQEQLGWNTHKETQPVYERAVHDQQMLALSELKRTKHWKMASKLILPESLSLLTFEDV
AVYFSEEEWQLLNPLEKTLYNDVMQDIYETVISLGLKLKNDTGNDHPISVSTSEIQTSGC
KVSKKTRMKIAQKTMGRENPGDTHSVQKWHRAFPRKKRKKLATCKQELPKLMDLHGKGPT
GEKPFKCQECGKSFRVSSDLIKHQRIHTGEKPYKCQQCDRRFRWSSDLNKHFMTHQGIKP
YRCSWCGKSFSHNTNLHTHQRIHTGEKPFKCNECGKRFIQNSHLIKHQRTHTGEQPYTCS
LCKRNFSRRSSLLRHQKLHRGREACLVSPN
Download sequence
Identical sequences H2PWV2
ENSPPYP00000023225 9600.ENSPPYP00000023225 XP_009233560.1.23681 XP_009233561.1.23681 XP_009233562.1.23681 ENSPPYP00000023225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]