SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009237213.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009237213.1.23681
Domain Number 1 Region: 2152-2245
Classification Level Classification E-value
Superfamily C-type lectin-like 1.41e-32
Family Link domain 0.00011
Further Details:      
 
Domain Number 2 Region: 508-646
Classification Level Classification E-value
Superfamily FAS1 domain 1.44e-30
Family FAS1 domain 0.0015
Further Details:      
 
Domain Number 3 Region: 1472-1520,1601-1712
Classification Level Classification E-value
Superfamily FAS1 domain 4.32e-28
Family FAS1 domain 0.0027
Further Details:      
 
Domain Number 4 Region: 1714-1867
Classification Level Classification E-value
Superfamily FAS1 domain 2.35e-25
Family FAS1 domain 0.0044
Further Details:      
 
Domain Number 5 Region: 964-1121
Classification Level Classification E-value
Superfamily FAS1 domain 6.67e-22
Family FAS1 domain 0.0049
Further Details:      
 
Domain Number 6 Region: 385-498
Classification Level Classification E-value
Superfamily FAS1 domain 1.83e-20
Family FAS1 domain 0.0037
Further Details:      
 
Domain Number 7 Region: 2243-2406
Classification Level Classification E-value
Superfamily FAS1 domain 2.49e-17
Family FAS1 domain 0.0089
Further Details:      
 
Domain Number 8 Region: 1139-1230
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000235
Family FAS1 domain 0.0084
Further Details:      
 
Domain Number 9 Region: 1544-1581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000921
Family Merozoite surface protein 1 (MSP-1) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009237213.1.23681
Sequence length 2514
Comment PREDICTED: stabilin-1 [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MAGPRGLLPLCLLAFCLAGFSFVRGQVLFKGCDVKTTFVTHVPCTSCAAIKKQTCPSGWL
RELPDQITQDCRYEVQLGGSMVSMSGCRRKCRKQVVQKACCPGYWGSRCYECPGGAETPC
NGHGTCLDGMDRNGTCVCQENFRGSACQECQDPNRFGPDCQSVCSCVHGVCNHGPRGDGS
CLCFAGYTGPHCDQELPVCQELRCPQNTQCSAEAPSCRCLPGYTQQGSECRAPNPCWPSP
CSLLAQCSVSPKGQAQCHCPENYHGDGMVCLPKDPCTDNLGGCPSNSTLCVYQKPGQAFC
TCRPGLVSINSNASAGCFAFCSPFSCDRSATCQVTADGKTSCVCRESEVGDGRACYGHLL
HEVQKATQTGRVFLHLRVAVAMMDQGCREILTTAGPFTVLVPSVSSFSSRTMNASLAQQL
CRQHIIAGQHILEDTRTQQTRRWWTLAGQEITVTFNQFTKYSYKYKDQPQQTFNIYKANN
IAANGVFHVVTGLRWQAPSGTPGDPKRTIGQILASTEAFSRFETILENCGLPSILDGPGP
FTVFAPSNEAVDSLRDGRLIYLFTAGLSKLQELVRYHIYNHGQLTVEKLISKGRILTMAN
QVLAVNISEEGRILLGPEGVPLQRVDVMAANGVIHMLDGILLPPTILPILPKHCSEEQHK
IVAGTCVDCQALNTSTCPPNSVKLDIFPKECVYIHDPTGLNVLKKGCASYCNQTIMEQGC
CKGFFGPDCMQCPGGFSKPCYGKGNCSDGIQGNGACLCFPDYKGIACHICSNPNKHGDQC
QEDCGCVHGLCDNRPGSGGVCQQGTCAPGFSGQFCNESMGDCGPTGLAQHCHLHARCVSQ
EGVARCRCLDGFEGDGFSCTPSNPCSHPDRGGCSENAECVPGSLGTHHCTCHKGWSGDGR
VCVAIDECELDVRGGCHTDALCSYVGPGQSRCTCKLGFAGDGYQCSPIDPCRAGNGGCHG
LATCRAVGGGQRVCTCPPGFGGDGFSCYGDIFRELEANAPFSIFYQWFKSAGITLPADRR
VTALVPSEAAVRQLSPEDRAFWLQPRMLPNLVRAHFLQGALFEEELARLGGQEVATLNPT
TRWEIRNISGRVWVQNASVDVADLLATNGVLHILSQVLLPPRGDVPGGQGLLQQLDLVPA
FSLFRELLQHHRLVPQIEAATAYTIFVPTNRSLEAQGNSSHLDADTVRHHVVLGEALSME
TLRKGGHRNSLLGPAHWIVFYNHSGQPEVNHVPLEGPMLEAPGRSLIGLSGVLTVGSSRC
LNSHAEALREKCVNCTRKFRCTQGFQLQDTPRKSCVYRSGFSFSRGCSYTCAKKIQVPDC
CPGFFGMLCEPCPGGLGGVCSGHGQCQDRFLGSGECHCHEGFHGTACEMCELGRYGPNCT
GVCDCAHGLCQEGLQGDGSCVCNVGWQGLRCDQKITSPQCPRKCDPNANCVQDSAGASTC
ACAAGYSGNGIFCSEVDPCAHGHGGCSPHANCTKVAPGQRTCTCQDGYMGDGELCQEINS
CLIHHGGCHIHAECIPTGPQQVSCSCREGYSGDGIRTCELLDPCSKNNGGCSPYATCKST
GDGQRTCTCDTAHTVGDGLTCRARVGLELLRDKHASFFSLRLLEYKELKGDGPFTIFVPH
ADLMSNLSQDELARIRAHRQLVFRYHVVGCQRLRSEDLLEQGYATALSGHPLRFSEREGS
IYLNDFARVVSSDHEAVNGILHFIDRVLLPPEALHWEPDDAPIPRRNVTAAAQGFGYKIF
SGLLKVAGLLPLLREASHRPFTMVWPTDAAFRALPPDRQAWLYHEDHRDKLAAVLRGHMI
RNVEALASDLPNLGPLRTMHGTPISFSCSRMRPGELMVGEDDARIVQRHLPFEGGLAYGI
DQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQGSPEACWRFYPKFWTSPP
LHSLGLRSVWVHPSLWGRPQGLGRGCHRNCVTTTWKPSCCPGHYGSECQACPGGPSSPCS
DRGVCMDGMSGSGQCLCRSGFAGTACELCAPGAFGPHCQACHCTVHGRCDEGLGGSGSCF
CDEGWTGPRCEVQLELQPVCTPPCAPEAVCRAGNSCECGLGYEGDGRVCTVADLCQDGHG
GCSEHANCSQVGRWMIGVEESEPPVDRCLGQPPPCHSDAVCTDLHFQEKRAGVFHLQATS
GPYGLNFSEAEVACEAQGAVLASFPQLSAAQQLGFHLCLMGWLANGSTAHPVVFPAADCG
NGRVGIVSLGARKNLSERWDAYCFRVQDVACRCRDGFVGDGISMCNGKLLDVLAATANFS
TFYGMLLGYANATQRGLDFLDFLNDELTYKTLFVPVNEGFVDNMTLSGPDLELHASNATL
LSANASQGKLLPAHSGLSLIISDAGPDNSSWAPVAPGTVVVSHIIVWDIMAFNGIIHALA
SPLLAPPQPQAVLAPEAPPVAAGVGAVLAAGALLGLVAGALYLRARGKPTGFGFSAFQAE
DDAEDDFSPWQEGTNPTLVSVPNPVFGSDAFCEPFDDSLLEEDFPDTQRILTVK
Download sequence
Identical sequences XP_009237213.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]