SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009237847.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009237847.1.23681
Domain Number 1 Region: 131-197
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000642
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000179
Further Details:      
 
Domain Number 2 Region: 200-272
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000198
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009237847.1.23681
Sequence length 536
Comment PREDICTED: fragile X mental retardation syndrome-related protein 1 isoform X3 [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKTVKKNTFFKCTVDVPEDLREACANEN
AHKDFKKAVGACRIFYHPETTQLMILSASEATVKRVNILSDMHLRSIRTKLMLMSRNEEA
TKHLECTKQLAAAFHEEFVVREDLMGLAIGTHGSNIQQARKVPGVTAIELDEDTGTFRIY
GESADAVKKARGFLEFVEDFIQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRIEGDNENK
LPREDGMVPFVFVGTKESIGNVQVLLEYHIAYLKEVEQLRMERLQIDEQLRQIGSRSYSG
RGRGRRGPNYTSGYGTNSELSNPSETESERKDELSDWSLAGEDDRDSRHQRDSRRRPGGR
GRSVSGGRGRGGPRGGKSSISSVLKDPDSNPYSLLDNTESDQTADTDASESHHSTNRRRR
SRRRRTDEDAVLMDGMTESDTASVNENGLVTVADYISRAESQSRQRNLPRETLAKNKKEM
AKDVIEEHGPSEKAINGPTSASGDDISKLQRTPGEEKINTLKEENTQEAAVLNGVS
Download sequence
Identical sequences A0A2I3RC12 A0A2J8WGW4 A0A2K5TM85 A0A2K6A2I9 A0A2K6BVC9 G1R1X9 G3SF62 H9EN89
9544.ENSMMUP00000038773 ENSP00000307633 gi|61835172|ref|NP_001013457.1| ENSP00000307633 ENSMMUP00000015875 ENSMMUP00000038773 ENSNLEP00000007201 NP_001013457.1.87134 NP_001013457.1.92137 XP_001168869.2.37143 XP_003256566.1.23891 XP_007970193.1.81039 XP_009237846.1.23681 XP_009237847.1.23681 XP_011736838.1.29376 XP_011824253.1.47321 XP_015301053.1.63531 XP_018879362.1.27298 ENSMMUP00000015874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]