SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009240133.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009240133.1.23681
Domain Number 1 Region: 454-535
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.58e-29
Family Forkhead DNA-binding domain 0.0000152
Further Details:      
 
Weak hits

Sequence:  XP_009240133.1.23681
Domain Number - Region: 308-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0381
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009240133.1.23681
Sequence length 668
Comment PREDICTED: forkhead box protein P4 isoform X7 [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MMVESASETIRSAPSGQNGVGSLSGQADGSSGGATGTTASGTGREVTTGADSNGEMSPAE
LLHFQQQQALQVARQFLLQQASGLSSPGNNDSKQSASAVQVPVSVAMMSPQMLTPQQMQQ
ILSPPQLQALLQQQQALMLQQLQEYYKKQQEQLHLQLLTQQQAGKPQPKEALGNKQLAFQ
QQLLQMQQLQQQHLLNLQRQGLVSLQPNQASGPLQTLPQAAVCPTDLPQLWKGEGAPGQP
AEDSVKQEGLDLTGTAATATSFAVPPKVSPPLSHHTLPNGQPTVLTSRRDSSSHEETPSS
HPLYGHGECKWPGCETLCEDLGQFIKHLNTEHALDDRSTAQCRVQMQVVQQLEIQLAKES
ERLQAMMAHLHMRPSEPKPFSQPVTVSAADSFPDGLVHPPTSAAAPVTPLRPPGLGSASL
HGGGPARRRSSDKFCSPISSELAQNHEFYKNADVRPPFTYASLIRQAILETPDRQLTLNE
IYNWFTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEREYQKRRPPKMT
GSPTLVKNMISGLSYGALNASYQAALAESSFPLLNSPGMLNPGSASSLLPLSHDDVGAPV
EPLPSNGSSSPPRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGTPNPSASGPPEDRDLEE
ELPGEELS
Download sequence
Identical sequences H2PJ03
ENSPPYP00000018562 XP_009240133.1.23681 ENSPPYP00000018562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]