SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009240821.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009240821.1.23681
Domain Number 1 Region: 75-135
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.1e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009240821.1.23681
Sequence length 190
Comment PREDICTED: class A basic helix-loop-helix protein 15 [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MKTKNRPPRRRAPVQDTEATPGEGTPDGSLPNPGPEPAKGLRSRPARAAAGAPGEGRRRR
PGPSGPAGRRDSSIQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLA
KNYIKSLTATILTMSSSRLPGLEGPGPKLYQHYQQQQQQVAGGALGATEAQPQGHLQRYS
TQIHSFREGT
Download sequence
Identical sequences H2PLH0
9600.ENSPPYP00000019452 XP_009240821.1.23681 ENSPPYP00000019452 ENSPPYP00000019452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]