SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009248678.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009248678.1.23681
Domain Number 1 Region: 41-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.25e-35
Family SCAN domain 0.0000915
Further Details:      
 
Domain Number 2 Region: 231-270
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.29e-16
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009248678.1.23681
Sequence length 273
Comment PREDICTED: zinc finger protein 75D [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MMMVDLKVAAYLDPQIRALWETKGPARESSGQSKKSPRMDSLDPKSSCWHFRNFTYDEAA
GPREAVSKLQELCHLWLRPAIHSKEQILELLVLEQFLTILPRETQTQMKKHHPQSIEEAV
ALVEHLQRESGQTWNGVAVHELRKEAVLLGETTEASSFRLKPTESQPVGISQDEEFWNTY
QGLQEQLSRNTHKETEPVYERAVPTQQILAFPGQTNTKDWTVTPERVLPESQSLLTFEEV
AMYFSQEEWELLDPTQKALYNDVMQETMRLSSL
Download sequence
Identical sequences H2NPY5
ENSPPYP00000007962 XP_009248678.1.23681 ENSPPYP00000007962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]