SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009251343.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009251343.1.23681
Domain Number 1 Region: 410-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.92e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 241-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.4e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 353-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.98e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 5 Region: 31-91
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.97e-22
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 6 Region: 451-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 185-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.08e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 507-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000983
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009251343.1.23681
Sequence length 570
Comment PREDICTED: zinc finger protein 430 isoform X1 [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MENLKSGVYPLKEASGCPGADRNLLVYSVYEKGPLTFRDVAIEFSLEEWQCLDTAQQDLY
RKVMLENYRNLVFLAGIAVSKPDLITCLEQGKEPWNMKRHAMVDEPPVIYSHFAQDLWPE
QGIKDSFQEVILRRYGKCGHEDLQLRTGYKSVDEYSLHKECYDELNQCLTTTQSEIFQYD
KYVNVFYKFSNPNIHKIRHTGKKPFKCKKCDKSFCMLLHLTQHKRIHVRENSYQCEECGK
VFNWFSTLTRHRRIHTGEKPYKCEECGKAFKQSSTLTTHKIIHTGEKPYRCEECGKTFNR
SSHLTTHKRIHTGEKPYRCEECGRAFNRSSHLTTHKIIHTGEKPYKCEECGKAFNQSSTL
TTHKIIHAGEKPYKCEECGKAFYRFSYLTKHKIIHTGEKFYKCEECGKGFNWSSTLTKHK
RIHTGEKPYKCEQCGKAFNESSNLTAHKIIHTGEKPYKCEECGKAFNRSPKLTAHKVIHS
GEKPYKCEECGKAFNQFSNLTKHKITHIGDTSYKYLECDKAFSQSSTLTKHKVIHTGEKP
YNCEEYGKVFNQSSNLIEQSNSYWRETLQM
Download sequence
Identical sequences K7EV74
ENSPPYP00000024455 XP_009251343.1.23681 ENSPPYP00000024455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]