SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009422412.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009422412.1.37143
Domain Number 1 Region: 359-551
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 83-184
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000357
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 196-275
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000114
Family Ras-binding domain, RBD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009422412.1.37143
Sequence length 1191
Comment PREDICTED: rho GTPase-activating protein 20 isoform X2 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MEAMSPQQETLGGQPGRSSSLTGVSRLAGGSGTKKKMKTLAERRRSAPSLILDKALQKRP
TTRDSPSASVDTCTFLSSFVCSSRTLLIDGRAELKRGLQRQERHLFLFNDLFVVAKIKYN
NNFKIKNKIKLTDMWTASCVDEVGEGNTNAMKSFVLGWPTVNFVATFSSPEQKDKWLSLL
QRYINLEKEKDYPKSIPLKIFAKDIGNCAYSKTITVMNSDTANEVINMSLPMLGITGSER
DYQLWVNSGKEEAPYPLIGHEYPYGIKMSHLRDSALLTPGSKDSTTPFNLQEPFLMEQLP
REMQCQFILKPSRLAAAQQLSDSGHKTFKRRRSIINWAFWRGSSTHLDNLPTSPTSTMPG
QLFGISLPNICENDNLPKPVLDMLFFLNQKGPLTKGIFRQSANVKSCRELKEKLNSGVEV
HLDCESIFVIASVLKDFLRNIPGSIFSSDLYDHWVSVMDQGNDEEKINTVQRLLDQLPRA
NVVLLRYLFGVLHNIEQHSSSNQMTAFNLAVCVAPSILWPPTSSSPELENEFTKKVSLLI
QFLIENCLRIFGEEITSLFREVSVRCDTRENASDISCFQLNDSSYDSLENELNEDVDAPC
SDLVKKLGQGSRSMDSVLTLSDYDLDQPEVEGLLTLSDFDLAHSKDEDVQMKRPLESKPV
NILVYTKIPLRDHARAPSAMCTPSYLSTAAANAAKSLRRHRRCSEPSIDYLDSKLSYLRE
FYQKKLRKSSCDAILSQKDEDYLKQNQPLQEEGKTCFKQSLVTGTDVSKKNATTQNTKKK
SLSGSEGNHVKLFPKSKPVAISVASYSPMSSQDHSKNQPFDVNTSGYSPPHTADALKGPR
THRRCSEPNIEDQNRKLTYLRGIYSKKQHKTSCEAGLLHGEEDYLKRHKSLQMEGQKLIN
QSLVMGIEVGKSSTTNQNTEKVLPPRLNLCPRTSYSSLSSPGTSPSGSSVSSQDSAFSQI
SEHSVFTPTETSSPIDCTFQAQRKREELSPDFSNASHVSGMPGPSSRQACSRPAYTKKDT
MEWHSQMHSVTLHPSTWLRNGVASLKNWSLKKKAKAARPEEEKIASPKGPLEPPPHASGV
PEANSLQEEQKDLPLRAAEGLSPVQSAQRCSSSPFQDSERHCSSPFSLVESRLKLCMKSH
EEIEPGSQSSSGSLPWERASASSWTLEDATSPDSGPTVVCDIEDRYLTKDI
Download sequence
Identical sequences K7BG92
9598.ENSPTRP00000007329 XP_009422412.1.37143 ENSPTRP00000007329 ENSPTRP00000007329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]