SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009426121.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009426121.1.37143
Domain Number 1 Region: 115-247
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.61e-46
Family Galectin (animal S-lectin) 0.00000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009426121.1.37143
Sequence length 250
Comment PREDICTED: galectin-3 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPRQAPP
GAYPGAPGAYPGAPASGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNL
PLPGGVVPRMLITILGSVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNN
WGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLAISGDI
DLTSASYTMI
Download sequence
Identical sequences H2Q8C5
ENSPTRP00000010805 ENSPTRP00000010805 9598.ENSPTRP00000010805 XP_001148424.2.37143 XP_009426120.1.37143 XP_009426121.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]