SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009433590.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009433590.1.37143
Domain Number 1 Region: 240-333
Classification Level Classification E-value
Superfamily Immunoglobulin 2.18e-19
Family I set domains 0.034
Further Details:      
 
Domain Number 2 Region: 601-681
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000996
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 512-593
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000105
Family I set domains 0.014
Further Details:      
 
Domain Number 4 Region: 139-242
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000131
Family C1 set domains (antibody constant domain-like) 0.075
Further Details:      
 
Domain Number 5 Region: 342-449
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000882
Family I set domains 0.013
Further Details:      
 
Domain Number 6 Region: 418-505
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000134
Family I set domains 0.06
Further Details:      
 
Domain Number 7 Region: 27-140
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000556
Family V set domains (antibody variable domain-like) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009433590.1.37143
Sequence length 847
Comment PREDICTED: B-cell receptor CD22 isoform X9 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MHLLGPWLLLLVLEYLAFSDSSKWAFEHPETLYAWEGACVWIPCTYRALDRDLESFILFH
NPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHVNDSGQLGLR
MESKTAKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEG
VPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKH
TPKLEIKVTPSDAIVREGESVTMTCEVSSSNPEYTTISWLKDGTSLKKQNTLMLNLHEVT
KDQSGKYCCQVSNDVGPGRSAEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPL
PTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPK
KVTTVIQNPTPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWGNT
TIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQ
FFWEKNGRLLGKESRLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSM
SPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQ
GTNSVGKGHSPLSTLTVYYSPETIGRRVAVGFGSCLAILILAICGLKLQRRWKRTQSQQG
LQENSSGQSFFVRNKKVRRAPLSEGPHSLGYYNPMMEDGISYTTLRFPETNIPRTGDAET
SEMQSPPPDCDDTVTYSVLHKRQMGDYENVIPDFSEDEGIHYSELIQFGVGERPQAQENV
DYVILKH
Download sequence
Identical sequences H2QG24
ENSPTRP00000018557 ENSPTRP00000018557 XP_009433588.1.37143 XP_009433590.1.37143 9598.ENSPTRP00000018557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]