SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009440859.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009440859.1.37143
Domain Number 1 Region: 31-128
Classification Level Classification E-value
Superfamily F-box domain 5.61e-21
Family F-box domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009440859.1.37143
Sequence length 155
Comment PREDICTED: F-box only protein 48 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MHKNSKRNNNSGVSHTEANSVDAEKEKNESQNNFFELLPAEITFKIFSQLDIRSLCRASL
TCRSWNDTIRNSDSLWKPHCMTVRAVCRREIDDDLESGYSWRVILLRNYQKSKVKHEWLS
GRYSNICSPISLPEKIMYPMDADTWGEILEAELER
Download sequence
Identical sequences H2R8S4
9598.ENSPTRP00000051920 ENSPTRP00000051920 ENSPTRP00000051920 XP_001167525.1.37143 XP_003830965.1.60992 XP_008954579.1.60992 XP_009440859.1.37143 XP_016804157.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]