SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009444709.2.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009444709.2.37143
Domain Number 1 Region: 50-546
Classification Level Classification E-value
Superfamily Sema domain 9.42e-102
Family Sema domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1410-1535,1701-1857
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.88e-33
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 887-978
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000198
Family Other IPT/TIG domains 0.019
Further Details:      
 
Domain Number 4 Region: 978-1068
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000063
Family E-set domains of sugar-utilizing enzymes 0.089
Further Details:      
 
Domain Number 5 Region: 1065-1146
Classification Level Classification E-value
Superfamily E set domains 0.0000000000175
Family E-set domains of sugar-utilizing enzymes 0.055
Further Details:      
 
Domain Number 6 Region: 549-601
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000994
Family Plexin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009444709.2.37143
Sequence length 1925
Comment PREDICTED: plexin-D1 isoform X1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MAPRAAGGAPLSARAAAASPPPFQTPPRCPVPLLLLLLLGAARAGALEIQRRFPSPTPTN
NFALDGAAGTVYLAAVNRLYQLSGANLSLEAEAAVGPVPDSPLCHAPQLPQASCEHPRRL
TDNYNKILQLDPGQGLVVVCGSIYQGFCQLRRRGNISAVAVRFPPAAPPAEPVTVFPSML
NVAANHPNASTVGLVLPPAAGAGGSRLLVGATYTGYGSSFFPRNRSLEDHRFENTPEIAI
RSLDTRGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVSAFLHPSDPPPGAQSYAYLA
LNSEARAGDKESQARSLLARICLPHGAGGDAKKLTESYIQLGLQCAGGAGRGDLYSRLVS
VFPARERLFAVFERPQGSPAARAAPAALCAFRFADVRAAIRAARTACFVEPAPDVVAVLD
SVVQGTGPACERKLNIQLQPEQLDCGAAHLQHPLSILQPLKATPVFRAPGLTSVAVASVN
NYTAVFLGTVNGRLLKINLNESMQVVSRRVVTVAYGEPVHHVMQFDPADSGYLYLMTSHQ
MARVKVAACNVHSTCGDCVGAADAYCGWCALETRCTLQQDCANSSQQHFWTSASEGPSRC
PAMTVLPAEIDVRQEYPGMILQILGSLPSLSGMEMACDYGNNIRTVARVPGPAFGHQIAY
CNLLPRDQFPPFPPNQDHVTVEMFVRVNRRNIVKANFTIYDCSRTAQVYPHTACTSCLSA
QWPCFWCSQQHSCVSNQSQCEASPNPTSPQDCPRTLLSPLAPVPTGGSQNILVPLANTAF
FQGAALECSFGLEEIFEAVWVNESVVRCDQVVLHTTRKSQVFPLSLQLKGRPARFLDSPE
PMTVMVYNCAMGSPDCSQCLGREDLGHLCVWSDGCRLRGPLQPMAGTCPAPEIRAIEPLS
GPLDGGTLLTIRGRNLGRRLSDVAHGVWIGGVPCEPLPDRYTVSEEIVCVTGPAPGPLSG
VVTVNASKEGKSRDRFSYVLPLVHSLEPTMGPKAGGTRITIHGNDLHVGSELQVLVNDTD
PCTELMRTDTSIACTMPEGALPAPVPVCVRFERRGCVHGNLTFWYMQNPVIMAISPRRSP
VSGGRTITVAGERFHMVQNVSMAVHHIGREPTLCKVLNSTLITCPSPGALSNASAPVDFF
INGRAYADEVAVAEELLDPEEAQRGSRFRLDYLPNPQFSTAKREKWIKHHPGEPLTLVIH
KEQDSLGLQSHEYRVKIGQVSCDIQIVSDRIIHCSVNESLGAAEGQLPITIQVGNFNQTI
ATLQLGGSETAIIVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIRE
EIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPSQTLNS
QGSSQAQETHPLLGEWKIPESCRPNMEEGISLFSSLLNNKHFLIVFVHALEQQKDFAVRD
RCSLASLLTIALHGKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSI
CMYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNV
SFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYIL
RDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLIDKKDNTLGRVKDLDTEKYFHLVLPT
DELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYF
FDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQ
AFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIQDMTPLSEQEMNAHLAEE
SRKYQNEFNTNVAMAEIYKYAKRYRPQIMAALEANPTARRTQLQHKFEQVVALMEDNIYE
CYSEA
Download sequence
Identical sequences H2QNC7
XP_009444709.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]