SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009449233.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009449233.1.37143
Domain Number 1 Region: 144-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000464
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 2 Region: 109-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  XP_009449233.1.37143
Domain Number - Region: 197-227
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0248
Family Mitotic arrest deficient-like 1, Mad1 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009449233.1.37143
Sequence length 292
Comment PREDICTED: epidermal growth factor-like protein 8 isoform X3 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MGSRAELCTLLGGFSFLLLLISGEGAKGGSLRESQGVCSKQTLVVPLRYNESYSQPVYKP
YLTLCAGRRICSTYRTMYRVMWREVRREVQQTHAVCCQGWKKRHPGALTCEAICAKPCLN
GGVCVRPDQCECAPGWGGKHCHVDVDECRTSITLCSHRCFNTAGSFTCGCPHDLVLSVDG
RTCTEGSPEPPTSASILSVAVREAEKDERALKQEIHELRGRLERLEQWAGQAGAWVRAVL
PVPPEELQPEQVAELWGRGDRIESLSDQVLLLEERLGACSCEDNSLGLGVNR
Download sequence
Identical sequences H2QSQ8
XP_009449232.1.37143 XP_009449233.1.37143 ENSPTRP00000030748 ENSPTRP00000030748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]