SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009457024.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009457024.1.37143
Domain Number 1 Region: 31-154
Classification Level Classification E-value
Superfamily L domain-like 1.12e-21
Family U2A'-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009457024.1.37143
Sequence length 226
Comment PREDICTED: leucine-rich repeat-containing protein C10orf11 homolog isoform X4 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MAGLVVRGTQVSYIGQDCREIPEHLGRDCGHFAKRLDLSFNLLRSLEGLSAFRSLEELIL
DNNQLGDDLVLPGLPRLHTLTLNKNRITDLENLLDHLAEVTPALEYLSLLGNVACPNELV
SLEKDEEDYKRYRCFVLYKLPNLKFLDAQKVTRQEREEALVRGAFMKVVKPKASSEDVAS
SPERHYTPLPSASRELTSHQGVLGKCRYVYYGKNSEGNRFIRDDQL
Download sequence
Identical sequences H2R7N4
XP_009457024.1.37143 ENSPTRP00000050620 9598.ENSPTRP00000050620 ENSPTRP00000050620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]