SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009466042.1.38621 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009466042.1.38621
Domain Number 1 Region: 119-240
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.23e-34
Family cAMP-binding domain 0.000000903
Further Details:      
 
Domain Number 2 Region: 248-372
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.5e-32
Family cAMP-binding domain 0.000000777
Further Details:      
 
Domain Number 3 Region: 15-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 2.62e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009466042.1.38621
Sequence length 381
Comment PREDICTED: cAMP-dependent protein kinase type I-beta regulatory subunit [Nipponia nippon]; AA=GCF_000708225.1; RF=representative genome; TAX=128390; STAX=128390; NAME=Nipponia nippon; AL=Scaffold; RT=Major
Sequence
MAAASSCNVEEDESLKGCELYVQKHNIQQILKECIVNLCIAKPDRPMKFLREHFEKLEKE
ECKQILARQKSSSQSDSHDDEISPPPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPK
DYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGDEGDNFYVIDQG
EVDVYVNGEWVTSIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGEKIVVQGEPGDDFFIITEGTA
SVLQRRSDNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLG
PCSEILKRNIQRYNSFISLTV
Download sequence
Identical sequences A0A091K430 A0A091M238 A0A091V9M9 A0A093H0P1
XP_005438259.1.10750 XP_009466042.1.38621 XP_009640119.1.23211 XP_009688414.1.43253 XP_013806353.1.3284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]