SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009469882.1.38621 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009469882.1.38621
Domain Number 1 Region: 485-649
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 3.01e-72
Family A middle domain of Talin 1 0.0000000638
Further Details:      
 
Domain Number 2 Region: 720-856
Classification Level Classification E-value
Superfamily I/LWEQ domain 3.01e-53
Family I/LWEQ domain 0.000000625
Further Details:      
 
Domain Number 3 Region: 2182-2368
Classification Level Classification E-value
Superfamily I/LWEQ domain 3.63e-51
Family I/LWEQ domain 0.00012
Further Details:      
 
Domain Number 4 Region: 1751-1883
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.34e-45
Family VBS domain 0.00000125
Further Details:      
 
Domain Number 5 Region: 1131-1267
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 9.1e-39
Family VBS domain 0.014
Further Details:      
 
Domain Number 6 Region: 195-308
Classification Level Classification E-value
Superfamily Second domain of FERM 1.18e-34
Family Second domain of FERM 0.000000435
Further Details:      
 
Domain Number 7 Region: 309-399
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-25
Family Third domain of FERM 0.00000822
Further Details:      
 
Domain Number 8 Region: 1372-1461
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000196
Family I/LWEQ domain 0.0084
Further Details:      
 
Domain Number 9 Region: 79-136
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000167
Family First domain of FERM 0.036
Further Details:      
 
Domain Number 10 Region: 1602-1718
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000022
Family VBS domain 0.042
Further Details:      
 
Domain Number 11 Region: 1500-1565
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000732
Family VBS domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009469882.1.38621
Sequence length 2386
Comment PREDICTED: LOW QUALITY PROTEIN: talin-1-like, partial [Nipponia nippon]; AA=GCF_000708225.1; RF=representative genome; TAX=128390; STAX=128390; NAME=Nipponia nippon; AL=Scaffold; RT=Major
Sequence
MVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERVPEAQMGQPNDFGLFLSDEDPKKGI
WLEAGKALDYYMLRNGDTMEYKKKQRPLKIRMLDGTVKTVMVDDSKTVTDMLMTICARIG
ITNYDEYSLVREIMEEKKEEVTGTLKKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGIDDNETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
YQCQIQFGSHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKVRLCXEEQXXPAPLRRGV
QGAPSSCLQXXXNRVGKGELGSWALPAIMRTGAGGPENFQVGTMLQAQLQITSGQMHRGH
MPPMTSAQQALTGTINSSMQAVHAAQATLDDFETLPPLGQDAASKAWRKNKMDESKHEIH
SQVDAITAGTASVVNLTAGDPADTDYTAVGCAVTTISSNLTEMSKGVKLLAALMEDEGGN
GRQLLQAAKNLASAVSDLLKTAQPASAEPRQNLLQAAGLVGQTSGELLQQIGESDTDPRF
QSQKADVLGSCLPLTQRRAGSALQQVVAVGVAPTISSPVCQEQLIEAGKLVAKSAEGCVE
ASKAATDDDQLLKQVGMAATAVTQALNDLLQHIKQHALGGQPIGRYDQATDTILNVTENI
FSSMGDAGEMVRQAYILAQATSDLVNAIKADAEGETDLENSRKLLSAAKILADATAKMVE
AAKGAAAHPDSEEQQQRLREGAEGRPTGAQPAGQAALPPVLTHACPSQHAAKQAAASATQ
TIAAAQHAASSNKNPAAQQQLVQSCKVVAEQIPMLVQGVRGSQSQPDSPSAQLALIAASQ
NFLQPGGKMVAAAKATVPTITDQASAMQLSQCAKNLAAALAELRTAAQKAQEACGPLEID
SALSLVQSLERDLQEAKAAARDGKLKPLPGETMEKCAQDLGNSTKAVSSAIAHLLGEVAQ
GNENYTGTSFPTGAGRGEGAAPAATDLFIPAGIAADTSMRMVGEASKRLLTDSFPPSTKS
FQEAQSQLNQAAAGLNQSANELVQASRGTPQDLAKSSGKFGQDFNEFLQAGVEMASQSPN
KEDQAQVVSNLKSISMSSSKLLLAAKALSADPAAPNLKNQLAAAARAVTDSINQLITMCT
QQAPGQKECDNALRELETVKELLENPTQTVNDMSYFNCLDSVMENSKVLGESMAGISQNA
KNSKLPEFGDSISAASKALCGLTEAAAQAAYLVGVSDPNSQAGQQGLVDPTQFARANQAI
QMACQNLVDPACTQSQVLSAATIVAKHTSALCNTCRLASSRTANPVAKRQFVQSAKEVAN
STANLVKTIKALDGEFNEENRERCRAATAPLIEAVDNLTAFASNPEFATVPAQISPEGRR
AMEPIVSSAKTMLESSAGLIQTARSLAVNPKDPPXWSVLAGHSRTVSDSIKKLITNMRDK
APGQRECDEAIEVLNGCMREVDQASLAAISQQLAPREDISQEALHNQMITAVQEISNLIE
PVASAARAEASQLGHKVSQMAQYFEPLFEPLIRAAIGAASKTPNHQQQMNLLDQTKTLAE
SALQMLYTAKEAGGNPKQAAHTQEALEEAVQMMKEAVEDLTTTLNDAASAAGVVGGMVDS
ITQAINQLDEGPMGEPEGTFVDYQTTMVKTAKAIAVTVQEMVTKSTTNPDELGILANQLT
NDYGQLAQEAKPAALTAENEEIGSHIKRRVQELGHGCAALVTKAGALQCSPSDAYTKKEL
IESARKVSEKVSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIMFATAGTLNRENSE
TFADHREGILKTAKALVEDTKVLVQNATASQEKASLGSEDPETQVVLINAVKDVAKALGD
LIGATKAAAGKAGDDPAVYQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATIEHI
RQELAVFSSPVPPAKVSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIA
DMLRACKEAAYHPEVSGDVRQRALRFGKECADGYLELLEHVLVILQKPTHELKQQLAGYS
KRVASSVTELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPK
QADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANAVDDGQWSQGL
ISAARMVAAATNNLCEAANAAVQGHASEEKLISSAKQVAASTAQLLVACKVKADHDSEAM
KRLQAAGDAVKRASDNLVKAAQKAAAFQDHDETVVVKEKMVGGIAQ
Download sequence
Identical sequences XP_009469882.1.38621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]