SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009484152.1.14425 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009484152.1.14425
Domain Number 1 Region: 435-656
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-56
Family DBL homology domain (DH-domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 138-250
Classification Level Classification E-value
Superfamily BRCT domain 6.2e-20
Family DNA ligase 0.035
Further Details:      
 
Domain Number 3 Region: 265-356
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000174
Family DNA topoisomerase II binding protein 1, TopBP1 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009484152.1.14425
Sequence length 914
Comment PREDICTED: LOW QUALITY PROTEIN: protein ECT2 [Pelecanus crispus]; AA=GCF_000687375.1; RF=representative genome; TAX=36300; STAX=36300; NAME=Pelecanus crispus; AL=Scaffold; RT=Major
Sequence
MADNSTLVSETGRSLLADSSVLDSKIIETSKENVFPGSVLDVEEEMPQIETRVVLVQEAG
KHEELLKALETIKIMEVPVIKIKETSPGKSEEKLIKSIIHMEIKVPYIKTDTIEEVGDSD
SPEFETIFVVSDFQDSIFNNLCKADCRVIGPPVVLHCAQKGEPLPFSCRPLYCASMLNLV
LCFTGFRKKDELVKLVTLVHHMGGIIRRDFSSKVTHLVANSTHGDKFRIAVSLGTPIVKA
EWIYKAWEKRNEIDFCAADDDFRNQFKVPPFQDCMLSFLGFSDDEKANMEEMTEMQGGHY
LPVGDERCTHLVVEESTVKDLPFEPLKKLYVVKQEWFWGSIQMDARAGESMYLFEKSESP
GLKKSVSLLSLNTPNSNRKRRRLKETLAQLTRETDMSPFPPRKRPSAEHSLSIGSLLDIS
NTPESSTTNGETPKSCARPSKNSTPLPVKQSARWQVAKELYQTESNYVDILTTIIQLFQV
PLEKEGQLGGPILAQEEIKTIFGSIPDILDVHTKIKEDLEDLMMNWTESKSIGDIILKYS
KDLLKTYPPFVNFFEMSKETITRCEKQKPRFHAFLKINQAKPECGRQSLAELLIRPVQRL
PSVALLLNDIKKHTAEENPDKITLERAIESLKEVMTHINEDKRKTEAQRQFFDVVYEVDG
CPANLLSSHRSLVQRLETVALGDDLCDRGEQVTLXLSSIXLQIARKRHKVIGAFKSPHGH
TRPPASLKHVVLMPLSQIKKVLDIRETEDCHKAFALVVRPPTELNNKLLSFQMTTEEPPK
EDWLKMLCRHVANTICKADAENLIYTADPDSVEINTKDMDSTLSRASRAIKKTSKKVTRA
FSFSKTPKRALRRALMSHSATEGRSPSSANESYIGSRLTSTSSLAGIPSPSLVSLPSIFE
KRSHTLSRSTTHLI
Download sequence
Identical sequences XP_009484152.1.14425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]