SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009495535.1.24044 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009495535.1.24044
Domain Number 1 Region: 2317-2502
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.22e-37
Family I/LWEQ domain 0.00033
Further Details:      
 
Domain Number 2 Region: 481-645
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.23e-29
Family A middle domain of Talin 1 0.0000549
Further Details:      
 
Domain Number 3 Region: 175-291
Classification Level Classification E-value
Superfamily Second domain of FERM 7.33e-28
Family Second domain of FERM 0.0000895
Further Details:      
 
Domain Number 4 Region: 292-382
Classification Level Classification E-value
Superfamily PH domain-like 1.43e-19
Family Third domain of FERM 0.00037
Further Details:      
 
Domain Number 5 Region: 1223-1347
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 9.42e-18
Family VBS domain 0.032
Further Details:      
 
Domain Number 6 Region: 748-880
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.16e-16
Family I/LWEQ domain 0.0014
Further Details:      
 
Domain Number 7 Region: 656-775
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000706
Family I/LWEQ domain 0.00072
Further Details:      
 
Domain Number 8 Region: 1861-1987
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000000000298
Family VBS domain 0.0095
Further Details:      
 
Domain Number 9 Region: 1070-1201
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000000000392
Family VBS domain 0.029
Further Details:      
 
Domain Number 10 Region: 1462-1550
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000216
Family I/LWEQ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009495535.1.24044
Sequence length 2557
Comment hypothetical protein H696_03395 [Fonticula alba]; AA=GCF_000388065.1; RF=representative genome; TAX=691883; STAX=691883; NAME=Fonticula alba; strain=ATCC 38817; AL=Scaffold; RT=Major
Sequence
MSKISLRVSIPKMGSTKTLQFSLDISIAEACREIRSSINEDPSSGADHGIFWPEQTKWLD
PRRTFNFYDLSSGATIEYRKKHRPQKVRLADESEKTWLVDDSLTIEQLTAFACEKLNILN
PDEYSFTTEKLEAKSREAAVEARRKGLSPPGDAWLIPSKTLKEQDVDESEVLIFRKKFFF
SDQNIDRNDPVQLNLVYNQAQQSIIRGVNPCTQDEAAQFAALQCQILTGNHEPDKHTKSG
FIEWKNYLPDEYVGKKDVEKKVYMEHRKIQGMTAENAKFRYIQLCRSLKTYGITFFHVKE
KLPRRNKLIDVLLGVTRDSVMRFDGETKALRDNFPLTTLRRWAATPTHFTMDFGDYADSY
LIFQTQEGDAISQLISGYIDIIVKKKKKEAERQFDDDEAEVAISDETIPASKATAITMVT
GQLGLQVEVNVSQPGVVGGAGSSSSSSGSMAQMMGSSSAGTLAGGRAGAQAGGQMSLENM
TDAQKALFQTIMSGFASINAAQSNLSITNVLPATGSDPAALQWRRHALDQNRQEVSSQLA
AHLASTASICTLTNVDVNKIDYPQVGTCVGSISSNLTVLTSGSKMVAALLDDPNASEALL
DACRQLSDATQRFFTAMQPVMLTGEKRQDMLGEARAVSAAASAMLQAMGEQDVSPSAQSL
LNELAKAVALAVSEAAQHSSKNITTKCENPTDRAAVAQAIRDSVLSASQLAVTTSIVAPS
IHTQLCQQELITNADQVEKCVNALVSRARQACNDGHANDQLAGMADRIRDALKRLIECAR
HGGQDAEEMSELERQAEIIISNIQTIIDNPSDSVRMISSIKTLVGASSKLSNLLKQQAME
SNDPAERDRLLDAARNLAGLTHALVEVGREAARNPNDPRIRENLLAASRNLQAATRAALT
LDQSHRKAFVRLLGAAKSNAATLTQLISAAKACSPYNRNQASQMQLINASKNVADRTGNL
ALAIREFSDNQDDPSSQLRLLAASKAMLAPGASSLAAARAASQTVGDQAAQARLLNISRT
AGDSLRRLKEAIDMAESLSGSLELDSAIDSVRASHGLIKQAQESHAAGTLQPGPDQSLEL
CELDAVANTKAIGTSLAQLCSAAAQGHESYTGVSARDSAAALQSLANAVTGVAACCTDRD
DGRALLEAARELLAQSEALIRSSKTCVGSKGDPEAQRDLAQHAAAVNRCMTALIEALPGQ
REINRSIASMRDQLQGFSGATPAPVAGDTFMTAQSRLTASAGALNVAASALVGAARSSPQ
QLQAAAQQLEQAFASLIAAGSAMQSQTSDPAVRAELDQYMNDVFNSVSSLLQSSMAYSAD
PSGNNLANLLNLAAKGVADSISNLLSLGASGAPGVKEANSVIQKLDYAVAKVDTVNSTVP
DTSDTYHQSLRKLADSQTALQQSFAAVTASSRGGVIQSDVGTHITKMGDSMLDVVDAAVR
ALYLIGVADPGSTEARRQVISAEQVSLSVKEVQNACGRLRDPATVGADIMAAATAIAQHT
SALCNACKAASVATSDPEAKQQFLGSAKAIATATGALVADIKSLTAHQHDPAARVAVETS
ARPLVEAVQALQTLSYSPEFAATPAKVSLTGQNTQAPLTHSSRDFVISSKDTVEAIKKLC
LDPTDVTQQAFNDLAKAVGDQLRRLVNQASQMAPGQLECNEAIDQVNMASAEIQAASVNA
AVGELQPTDPTKTTDSAQLSQVLLNNYRAVLSSAELVAASSKTGHHFAQAVETLSENFEP
FATATIDTAAAASVNGLGQDYQDRLLEAAKNFSEAVAALLYPVKAAGGNPDATAQHMRVD
QQLARLQDAGKELVRTVEGGSGGDYEIINDSIATVSGAMERLAVPIAAGSPDSPSAAGGA
HAGRPYNELADEVIAGTRVLAQQLGELARARTSAEVSRLATDIAHSFNLLADTAHAAAGA
TNEADVSTSILDAVRLLGGSMIRLLDSSKLVAANPNDMQARSKAGTSSREATTNVSRLVA
AVKTGSKGVQACEHALFVIDDILADLDTTLMFASSGTLDPIGQSQPFGHYKEPIAGVTRE
LAGNVKALLESISQTQDHLAEASGNSADSMATLRDHIKNAVTAVSSADVKAQTQLLEACI
AVAQQLKDNIEASVRATSRRPEDIANMRTSTKRMTETIQNLISAVKLVGDESTRALRSLD
SSMDAVRASIAQLRSDDPVQGTALPEDVVLSAKAVTAAAVTLVSASTATGPAAQDDLIKA
STAARVAVDDLLRAGKAVSAEAPEDKRAQMHNACAKGAESVLTLFDTLKAVLGASRSGDQ
VTTNAMRGKLQNSAKQVADSINLVVGAAGHMVPTGYVDPNDPNVIAERELLAAASAIEAA
ARKLAALQPAEGPRAANEDLPFEEQIVEAAKAIAMATSALVRSATHTQREIVANDRQTSV
RAGTPYHSDGTWSDGLVSAAKAVASATGELCEAANDMVQGKADRARIIATSRAVSGSTQQ
LLSAATVKSSITSHESQNRLRGAGAQVSKATRALIEAAEQNAALDTNPADEVSELMASGI
GSRKAEIELQMKMLRMEQELEEARRALSSMRRQRYDK
Download sequence
Identical sequences A0A058Z6M8
XP_009495535.1.24044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]