SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009515745.1.77131 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009515745.1.77131
Domain Number 1 Region: 312-472
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.89e-38
Family Ypt/Rab-GAP domain of gyp1p 0.002
Further Details:      
 
Domain Number 2 Region: 451-552
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.54e-18
Family Ypt/Rab-GAP domain of gyp1p 0.0095
Further Details:      
 
Domain Number 3 Region: 5-94
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000327
Family Synaptotagmin-like (S variant) 0.071
Further Details:      
 
Weak hits

Sequence:  XP_009515745.1.77131
Domain Number - Region: 186-229
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0129
Family PLC-like (P variant) 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009515745.1.77131
Sequence length 659
Comment hypothetical protein PHYSODRAFT_467548 [Phytophthora sojae]; AA=GCF_000149755.1; RF=representative genome; TAX=67593; STAX=67593; NAME=Phytophthora sojae; strain=P6497; AL=Scaffold; RT=Major
Sequence
MDRKRLCVEVVGARNLESPQSVDAYCVVGLCDVKPRKGARSRLAAYPSFRSSTVTDSSSP
TWAHVAEFVVPARPSSVRLRVQLFSEKNFFFDMFPSSSTGSLSDEEGGEKGADLAGNAGK
EQKKAAVVVKPKLVVTGWKGIHDSDSDDVVTLSEEEDEEEEEEFVEDEAWSAIEENSAVA
EESIDDQMLGVVEINSSLLCKPSRVVTDAWYSLGGTRTGEVRIRTAWYERSKRALTAQDR
EMLFEQHVNQAVTKPMNDFYGFAIPEAAREDWLHLRSYQDCREERRVEDWTKLYGTQFPE
RLRRCSYKEKDTEEKTLLMQLARAGIPRHLRERAYMNLSGASEKQANAGPDYYANLVKEA
ETMETETFRQIELDIDRTFGHSGTTICSEAGRGQLRRILRAYSLRNPSVGYCQGLNFIVA
FFLLMADEEVVFWLLSVFCEDLYPGYYSPAMADIQRDMRVLKQLIAEELPQLDDFTAEVG
LPLELLGSQWLLCLFTTTFPSETVFRIFDCIFTEGSYFVFPVIMTHLRKLEPTLLDLDEF
HRVLSSIKDAESVCIDGDLFMAAVCKEAESITPSRIQQLREEQCGSVRSEMERAERARAF
NQQLAVVYQIPAFSNYAAGLLRFFHEEAEVSSRSDVAFVLTMLCHGLVWLAEHSKRWQR
Download sequence
Identical sequences G4YIQ0
67593.JGI134863 jgi|Physo1_1|134863|estExt_fgenesh1_pg.C_340099 XP_009515745.1.77131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]