SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009552771.1.39223 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009552771.1.39223
Domain Number 1 Region: 312-394,433-445
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000951
Family Ubiquitin-related 0.063
Further Details:      
 
Domain Number 2 Region: 112-202
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000425
Family Thioltransferase 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009552771.1.39223
Sequence length 494
Comment hypothetical protein HETIRDRAFT_455980 [Heterobasidion irregulare TC 32-1]; AA=GCF_000320585.1; RF=representative genome; TAX=747525; STAX=984962; NAME=Heterobasidion irregulare TC 32-1; strain=TC 32-1; AL=Scaffold; RT=Major
Sequence
MLSILVFPFHVVASIIRFVFGTLRIPLPQWRFSSLNFYRPLGGRGAPPSYDPYSVADRWV
RSLEDETGALCMSRARVGSTATFSGSHSAGSSNTSALPSSANIRGRYGSTSRKILPDFFL
GSYEETLQTCQREAKIGCIVLVSNEHDDVAEFKRNTLTDPILVDLMHTNDFLVWGGDVRD
REGWSAAQKLQVTTYPFVAFLALQPSRGSSSFNSSSNTRASASPSLTVLSRHQGRSSSSG
PTSPTTLVDHITHQLLPRVSPFLERIKHSIRERELERRLREEQDRAFAESARRDREKIDA
LVLSEKLAEEARRAEEDRIAREKAESARRENIKAVWRHQAREALIPPEPVDGPDLIRVSF
RLPDGRRLVRILRPTDTVTALYCFVDTHVVPPSSTGISTDADNEKLPTPTSGELGLEGLI
ELSNMDADDWWGFKLFLAYPRRDISWSPDVRLGGIEGLDRGGQIVVEFVDKVRGDIGRQD
EGGDEDGYDTEEST
Download sequence
Identical sequences W4JP57
XP_009552771.1.39223 jgi|Hetan1|39466|estExt_Genewise1.C_130339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]