SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009637638.1.23211 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009637638.1.23211
Domain Number 1 Region: 584-728
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.22e-45
Family Toll/Interleukin receptor TIR domain 0.000000219
Further Details:      
 
Domain Number 2 Region: 39-176,338-478
Classification Level Classification E-value
Superfamily L domain-like 4.76e-36
Family Ngr ectodomain-like 0.025
Further Details:      
 
Domain Number 3 Region: 443-547
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000385
Family Ngr ectodomain-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009637638.1.23211
Sequence length 730
Comment PREDICTED: toll-like receptor 2 type-1 [Egretta garzetta]; AA=GCF_000687185.1; RF=representative genome; TAX=188379; STAX=188379; NAME=Egretta garzetta; AL=Scaffold; RT=Major
Sequence
MFNQTKHKSRTTHTWGVWAIYMFLAVNLSEEQVLQQACPSCDATQICNCSSMDLDFIPTG
LTAKITVLNLAHNRIKHIRSQDLQQAVNLRALLLQSNKISSMDKDSFRSLGKLELLDLSN
NSLTHLSPAWFGHLFSLQHLHLQGNSYRDLGESSPFSSLRNLSSLHLGNPQFSTIRQGNF
EGIELLDKLWIDGGNLIQYEPGSLKLIKKVNHMIINIRNTSVFSTIVRDLLHSVVWLEVR
EIKVEIENKSLVENSTLPFRMQKLTFKDASFTDQYVSRLLVLLKEITTLQELEVIDCVLE
GKGDWNSKEIQSGGQSFVERISVINITIQTFYLFMDLEGIESQINKLKSLTIASAKVFMV
PCKLAKHFSSLQYLDFHDNLLVNNRLNETICKDAWPSLQTLNLNQNSLKSLKQTADSVAR
LPKLIHLDISQNNFGAIPDVCEWPKTLKYLNLSSTQIPKLTTCIPLTLEVLDVSSNNLKE
FGLQLPFLRELYLAKNQLKTLPGAAPIPNLVAMSVRRNKLNSFSREEFESFKKMELLDAS
DNNYIWVLPVLVAVGYKYHAVWYMRMTWAWLQAKRKPKRAPAKDICYDAFVSYSENDSDW
VENIMVRELEQACPPFRLCLHKRDFVPGKWIVDNIIDSMEKSHKTLFVLSEHFVRSEWCK
YELDFSHFRLFDENNDAAILILLEPIQSKAIPKRFCKLRKIMNTKTYLEWPLEEEQQEMF
WENLKGALKS
Download sequence
Identical sequences XP_009637638.1.23211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]