SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009639000.1.23211 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009639000.1.23211
Domain Number 1 Region: 16-268
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.29e-69
Family Ankyrin repeat 0.0000364
Further Details:      
 
Domain Number 2 Region: 247-364
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000124
Family Ankyrin repeat 0.011
Further Details:      
 
Domain Number 3 Region: 455-501
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000196
Family SOCS box-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009639000.1.23211
Sequence length 544
Comment PREDICTED: ankyrin repeat and SOCS box protein 3 [Egretta garzetta]; AA=GCF_000687185.1; RF=representative genome; TAX=188379; STAX=188379; NAME=Egretta garzetta; AL=Scaffold; RT=Major
Sequence
MDFTEAYSDRCSAVGLAAREGDVKMLRKLIKQGYSIDVPDNRGWVPIHEAAARNSSECLR
LLVRAAPSDDYINSKTFEGMCALHLSARHGALESVRVLLEAGADPNEVTTEATTPLFLAV
ENGHADIVKFLLQHGANVKGLHSWSGWNSLHQASFQGCTEIMKILLEKGASKECKDDFGI
TPLFVAAQYGKLESLRLLVSHGADINCQAKDKATPLLIAAQEGHAECVELLLSKGADPNL
YCNEDNWQLPIHAATQMGHKKILELLIPVTDRICDKGKGKVSPVYSAVYGGNKDCLEMLL
KAGYSPDAQECLNFDCRSPMCMVFQKEFFYFIDVFLKYGITLLGINLGYCLFHEKFTLFQ
RFLKRGCLLPSGDQLSEFISYAVKAHEEYKEWLPYLLLAGFNPVNLMRRFWIFSVSENAL
NFILEFTNWKRLPPAVEQDLSDYKEKFAWTPKSHFAFIPSLSHLCRLEIRSILTSERLRS
DRFIRELPLPACLQDYLLYLDVLRVNAIPEAEDYLGQREEGAPSASHSSAEDAERGHACN
AGVR
Download sequence
Identical sequences A0A091ILN2
XP_009639000.1.23211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]