SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009643116.1.23211 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009643116.1.23211
Domain Number 1 Region: 217-288
Classification Level Classification E-value
Superfamily Homeodomain-like 6.42e-18
Family Homeodomain 0.0000519
Further Details:      
 
Domain Number 2 Region: 43-74
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000399
Family LIM domain 0.043
Further Details:      
 
Domain Number 3 Region: 14-42
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000224
Family LIM domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009643116.1.23211
Sequence length 398
Comment PREDICTED: insulin gene enhancer protein ISL-1 [Egretta garzetta]; AA=GCF_000687185.1; RF=representative genome; TAX=188379; STAX=188379; NAME=Egretta garzetta; AL=Scaffold; RT=Major
Sequence
MGDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDETCTCFV
RDGKTYCKRDYIRYAIYVVLFFGWLRSTRWAPRGWAVLDTRVGAFSHVHLRVGELSRCPP
RETRNPPHTPACDPRNPLFAVRGCQRRVALSLLPEGGLEPRLQPLQGAGLRPSAAPAASG
ACGEAVLSAGGSGVRKEIDFITTGEHLGSEPISARQPALRPHVHKQPEKTTRVRTVLNEK
QLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRSIMMKQLQQQQP
NDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDFALQSDIDQPAFQQL
VNFSEGGPGSNSTGSEVASMSSQLPDTPNSMVASPIEA
Download sequence
Identical sequences XP_009643116.1.23211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]