SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009783301.1.57364 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009783301.1.57364
Domain Number 1 Region: 301-400
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000717
Family Ankyrin repeat 0.0063
Further Details:      
 
Domain Number 2 Region: 346-363,576-630
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000106
Family Pseudo ankyrin repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009783301.1.57364
Sequence length 859
Comment PREDICTED: uncharacterized protein LOC104231927 isoform X2 [Nicotiana sylvestris]; AA=GCF_000393655.1; RF=representative genome; TAX=4096; STAX=4096; NAME=Nicotiana sylvestris; AL=Scaffold; RT=Major
Sequence
MSSSPSNSHVHESPCLNLAASTTNGNFQKPPSPIQAESTNHDDYHTVSIPNPAEITSDDE
YDTVSVPNQAEITSNVNFQESPSPSLTASSTSKGETPSPNLAANTSNDKSEELLLKCLPL
CRAILRGDEHGFDQAAQALAAASSSNSNFHRPRSPNVPNLAASTSRQSPSPNLAANTRSS
KTQVLTPYSPAIPRSGRMENLYSLAARTNRSSFEEIGEENINEEKKLWGCLPLYRALLRE
NQSGFEKEAKALSKFPPDVTICRKVTRAGDTGLHVLVGAGKWYDSVISKPKSYALEGLVI
RNNNGHTPLCVAAKVGNMEAAKKLLQLETEIRSVRATHDDTVGRYPIIEAARYGHKEMVL
LLIGDMATKMADSPPTKESAASTFLHLLVVAEFYDVLLALVRRFPGLARAEFYGDNDDVS
LLSLMAETPSAFRSGTQLGFWQRLLYSVAQANLERRLSDIEKSFVVNQPSVTVPSTESPQ
PTNELTWECFVKYPRNCVITIQAWLARMINRAIFKRIKDIKLMHKETLDIVKRLCKELMK
EYKPKDIEPVLRKAVLLAASSGIPEIIEEIVDCYPDAIWFVNSENHNLFHLAVINRHEKV
FNFIYQLSLYKHLVTTDEDTSGNNILHMAGKLAPLGRLNLISGAALQMQRELQWFQEVEK
FVHPTLRTNRNSYGKTPKMVFTEEHKELVKEGEKWMKETANSCTFVAALTATVGFAAAIT
VPGGNQSKGFPIFSKEPAFTIFAVSVAFCLFSSVASVLMFLSILTARYAETDFLRSLPKR
LIIGLGTLFISMTSLMIAFGATIYLVFGQKNGLILIPVGIAGLIPVILFESLQFRLLLDM
CMSTYGPSIFHKQSSRLLY
Download sequence
Identical sequences A0A1U7X0W1
XP_009783301.1.57364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]