SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009831918.1.97551 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009831918.1.97551
Domain Number 1 Region: 448-622
Classification Level Classification E-value
Superfamily Bet v1-like 4.94e-26
Family STAR domain 0.0078
Further Details:      
 
Domain Number 2 Region: 161-244
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000575
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009831918.1.97551
Sequence length 660
Comment hypothetical protein H257_07918 [Aphanomyces astaci]; AA=GCF_000520075.1; RF=representative genome; TAX=112090; STAX=112090; NAME=Aphanomyces astaci; strain=APO3; AL=Scaffold; RT=Major
Sequence
MTSKTIPRKQPMSPSSSKPSESMSPRHNTSAARTSSNPEDIMMLFDKICSDYFMARYAST
DSGRHILLSSLTKLCRVINRQQVSDKMNARIAAYCDALVADARKKEHDMKRAAKDDIQIE
VALRDWMKPKFLHLLEEMRLEFELNYTGSMPDVVGKEVAALGEIRIEGWLRKKGAHVNLW
RERYFMIRSSANGTHILCYFRKKGDREPRGWYVLGPGCTVDEVRESPSLMESKKLFTFRI
RHYSNKLTDDNSNGSSEEGADMLPPPPQTASVQTSQPPPPFPSHPPSLLSSSSSGDGFDF
NFDPKANIKKARMKKMAVAATAATAATATLVLTGGLAGIGMVGVGAAAFSSAALTASAGS
YLTKTHTAPIALAAESLETAIWWRNCLLECITQAEHHWRKYVQWYLAQDDNDESLGDPML
VAPPASIGPTPRPIKKQLAWLRHVLVGATHRSWTLHAQTTNLRVHRLRHPTTTHAAVLKA
SLSIPGASAAQVFDMLYQLDSPFYMANSVIQHAKIVASVDTHNDVMWWQLHPVALWPVVA
EARDAVLARHWRRDANGTYVLVLHSTSHRDCPSTRHVRADVVNASFVVAPPSVEYVSSDN
DDTSCLVTFVLHINPRGWLDSAVAAHLAYPHSFTVAMLDMLVDLKGACVAQQYKPPPKTT
Download sequence
Identical sequences W4GF63
XP_009831918.1.97551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]