SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009848044.1.73169 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009848044.1.73169
Domain Number 1 Region: 7-107
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.1e-28
Family Thioltransferase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009848044.1.73169
Sequence length 109
Comment hypothetical protein NEUTE1DRAFT_93791 [Neurospora tetrasperma FGSC 2508]; AA=GCF_000213175.1; RF=representative genome; TAX=510951; STAX=40127; NAME=Neurospora tetrasperma FGSC 2508; strain=FGSC 2508; AL=Scaffold; RT=Major
Sequence
MSDAATQKAKQLINDNAVVVFSKSYCPYCSNTKQILDGLNAKYATYELNQESDGSDVQDA
LLKLTGQRTVPNIFIGKQHIGGNSDLEAVVKNGKNGKKIQELLQEAGAL
Download sequence
Identical sequences F8MET5 G4UF75 Q9P718
5141.NCU01219.1 jgi|Neute1|179994|fgenesh2_kg.42__7__524_1_CCGZ XP_009848044.1.73169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]