SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009858805.1.78797 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009858805.1.78797
Domain Number 1 Region: 79-90,214-261,299-499
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-51
Family Nuclear receptor ligand-binding domain 0.00000672
Further Details:      
 
Domain Number 2 Region: 7-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.26e-29
Family Nuclear receptor 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009858805.1.78797
Sequence length 504
Comment PREDICTED: nuclear receptor isoform X1 [Ciona intestinalis]; AA=GCF_000224145.2; RF=representative genome; TAX=7719; STAX=7719; NAME=Ciona intestinalis; AL=Chromosome; RT=Major
Sequence
MKYSLDEVCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNGKKYTCVHTSKCHIDKDQRKG
CQACRFQKCLRVGMKLEAVRRDRVRGGRNKFGPLYKQDRARKQRLKALSEVHDSSTTITN
LTLSVETTKVEFCEPVPLIQTPTPTNNECYVTPSHDSIWPSSLESPSTSSIMSVLPQPYI
SHSPSPNTSSLGSTGDLTVRNISGNSYIEPPTFHPPPDPMQTHYPLLWGAHPAMNPTLPP
TYLSMGPIPAPYQLLPFSPNSVIEGFQRGFYVPLLIDQLLKYEIVESEIKTRIGTSLLDV
THRSDVFQLICKIADQTLYAMVEWAKKSVFFADLQVSDQMKLLQDSWIELLILDHIQRQL
KLKSDSIELVTGHKFPRDLSKVSSHCVITFRILKRLMDLEKKFAVLQVDEQEIACLKYLV
LFDTESHTAGCPNVQEKVNEALCEYSKKNYMDQPDRVNKLIFRLSEIRAVSSQIEDYLHY
KHHEGKLTEGSLLVELLKARENGP
Download sequence
Identical sequences F6WPT0
XP_009858805.1.78797 ENSCINP00000009479 ENSCINP00000009479 7719.ENSCINP00000009479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]