SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009881191.1.48241 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009881191.1.48241
Domain Number 1 Region: 196-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000113
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 2 Region: 838-890
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000447
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 331-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000813
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 674-720
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000089
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 5 Region: 895-944
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000152
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 805-846
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000212
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 7 Region: 712-770
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000623
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009881191.1.48241
Sequence length 1174
Comment PREDICTED: zinc finger protein ZFAT isoform X1 [Charadrius vociferus]; AA=GCF_000708025.1; RF=representative genome; TAX=50402; STAX=50402; NAME=Charadrius vociferus; AL=Scaffold; RT=Major
Sequence
MCKLCNLFSPNQSELLSHVSEKHTEEGTNVDDIIIPLQPLTVPTNTNKDAEELLVVKRKR
GRPKGSTKKFCVDEDVAENNPVQSEETPPGTEEGPELSEVSPGSLECRKCNRKFSNTRQL
RKHICIIVLNEAEEEGDGGATKIVPVEAAPQESEPTTPEATVQDPSQRRGYQEYAIQQTP
YEQAMKSSRLGPTQLKIFTCEYCNKVFKFKHSLQAHLRIHTNEKPYKCSYCSYASAIKAN
LNVHLRKHTGEKFSCDYCTFTCLSKGHLKVHIERVHKKIKQHCRFCKKKYSDVKNLIKHI
KETHDLQDKKVKDVFDELRLMTREGKRQLLYDCHICERKFKNELDRDRHMLVHGDERPFA
CELCGHGATKYQALELHVRKHPFVYVCSVCLKKFVSSVRLRAHIKDVHADLQETSVFDSS
INQSFCLLEPGGDIQPEALGEQLAQSAAELTIMSTDAINTPQPSACKGESTAAEVNRNGQ
HNGDLKIDTVPLLEFENPPVENVTEMLCQTTDTEVPNIQSCVASDCFLLKNGTSGSEELK
VSSANEEEINHCSSVNEQGEEMQLLLSEDKNLNTSQNNAVTENISVSEERNHSVPSSESE
TSNPPIQNSTETTNPLPAPEANAALSPQAASSNAVTSDGGSGAAAFMQILDSLQKRQMNT
ELCERIRKVYGDLECEYCGKLFWYQVHYDMHVRTHTREHLYYCSQCNYSSITKNCLKRHV
IQKHSNILLKCPTEHCDYSTPDKYKLQAHLKVHTELDKKSYSCPVCEKSFSEDRLIKSHI
KTNHPEVSMTTISEILGRRVQLKGLIGKRAVKCPYCDFYFMKNGSDLQRHIWAHEGVKPF
KCSLCEYATRSKSNLKAHMNRHSTEKTHLCDMCGKKFKSKGTLKSHKLLHTADGKQFKCT
VCDYTAAQKPQLLRHMEQHVSFKPFRCAHCHYSCNISGSLKRHYNRKHPNEEYVNVGSGE
PAAEALIQQGGIKCPVCSFVYGTKWEFNRHLKNKHGMKLVEHDGETKWELTAEVSEEAST
QYLHITESGEDVQGTQAAVAALQNLRYTSENGERLDPTAVNILQQIIELGSETHDATAVA
SVVTMAPGTVTVVKQVKEEEQSANHTLMIQETLQQASVELSEQHHLVVSSDEVEGIETVT
VYTQGGEASEFIVYVQEAMQPVEEQTVEQSVQEL
Download sequence
Identical sequences XP_009881191.1.48241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]