SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009883100.1.48241 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009883100.1.48241
Domain Number 1 Region: 235-305
Classification Level Classification E-value
Superfamily Homeodomain-like 1.97e-20
Family Homeodomain 0.0022
Further Details:      
 
Domain Number 2 Region: 78-146
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000057
Family LIM domain 0.014
Further Details:      
 
Domain Number 3 Region: 44-77
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000227
Family LIM domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009883100.1.48241
Sequence length 378
Comment PREDICTED: LIM/homeobox protein Lhx9 isoform X2 [Charadrius vociferus]; AA=GCF_000708025.1; RF=representative genome; TAX=50402; STAX=50402; NAME=Charadrius vociferus; AL=Scaffold; RT=Major
Sequence
MLFHGISGGHIQGIMEEMERRSKTESRLAKGGQMNGRETNMPPMSPEKPALCAGCGGKIS
DRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLG
ISASEMVMRARESVYHLSCFTCTTCNKTLTTGDHFGMKDNLVYCRAHFESLLQGEYPPQL
SYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGVDIVNYNSGCNENEADHLDRDQQ
PYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNAR
AKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDLTNPTITVVTSVTSN
LDSHESGSPSQTTLTNLF
Download sequence
Identical sequences A0A1V4JYC0
XP_009472695.1.38621 XP_009634483.1.23211 XP_009634484.1.23211 XP_009883100.1.48241 XP_014799068.1.91963 XP_014799069.1.91963 XP_014799070.1.91963 XP_014799071.1.91963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]