SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009939314.1.35112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009939314.1.35112
Domain Number 1 Region: 476-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.59e-21
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 2 Region: 363-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.8e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 533-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-20
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 141-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-19
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 5 Region: 574-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-18
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 84-141
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.99e-18
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 7 Region: 419-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-17
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 8 Region: 2-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-17
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 9 Region: 308-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.19e-17
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 10 Region: 197-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 11 Region: 270-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000191
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 12 Region: 653-683
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000017
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009939314.1.35112
Sequence length 715
Comment PREDICTED: zinc finger protein 260-like [Opisthocomus hoazin]; AA=GCF_000692075.1; RF=representative genome; TAX=30419; STAX=30419; NAME=Opisthocomus hoazin; AL=Scaffold; RT=Major
Sequence
MSVTFEDVAIYFSPEEWAELAGWQRRLYREVMLENYQAVALLGLCRSQASSLQESGRGDK
GEARGGCRRREVGQERGAEQGEMSFKSQTTLTKHKRRHTIRRPFSCTDCGKRFTSRHDLA
RHQRVHTGEKPFACSHCPKAFGDKRSLTIHQRVHTGERPFACAHCPKTFRDRKTFTVHQR
IHSGEKPFACSHCGHRFRQKGHLVSHHRIHTGERPFTCTHCPKAFRDRKTFTVHQRIHTR
EHHFGCAHCPKAFKDRRTLTIHQRTHSKQPFVCSHCGRCFSDKPNLDSHQSIHNGEKPFA
CSHCGQHFKHKDDLVRHQRIHTGECPFACTHCPKAFRDRKTFTMHQRIHTGEDHFACAHC
SKAFKDKRTLTIHKRIHSSEKPFACSQCDHRFTYKRNLVSHQRIHTGEKPYNCGQCGKSF
SWKASLVSHQRIHTNEEPCSCSDPCGYRFSYKHHLVSHQRIHTGERPFACTRCPKTFSVK
STLTAHQRVHSSEKPFNCTECGRSFNRKANFITHQKIHRGERPFICGECGKGFCTKKTFI
LHQNIHIGDRPFGCSECGKSFSRNGYLMRHRRIHTGERPYACAECPKAFRDEKALSIHQR
IHTGEKPYKCGKCGKTYSRNQYLKNHQRVHQDPPVVPEGGQWEETCPSLVGGHMEAKPFQ
CSGCEKRFRDEGIMLAHQRTHSNPSLWLPSPPPPKTVTEGPRGHRGLLGGPVFVP
Download sequence
Identical sequences XP_009939314.1.35112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]