SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009942019.1.35112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009942019.1.35112
Domain Number 1 Region: 489-654
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 2.09e-72
Family A middle domain of Talin 1 0.0000000609
Further Details:      
 
Domain Number 2 Region: 697-833
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.96e-53
Family I/LWEQ domain 0.000000577
Further Details:      
 
Domain Number 3 Region: 1760-1892
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.18e-45
Family VBS domain 0.00000125
Further Details:      
 
Domain Number 4 Region: 1146-1280
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.46e-38
Family VBS domain 0.012
Further Details:      
 
Domain Number 5 Region: 195-308
Classification Level Classification E-value
Superfamily Second domain of FERM 7.72e-35
Family Second domain of FERM 0.000000392
Further Details:      
 
Domain Number 6 Region: 309-399
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-25
Family Third domain of FERM 0.00000822
Further Details:      
 
Domain Number 7 Region: 2218-2319
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.29e-22
Family I/LWEQ domain 0.0012
Further Details:      
 
Domain Number 8 Region: 1385-1474
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000157
Family I/LWEQ domain 0.0084
Further Details:      
 
Domain Number 9 Region: 1016-1110
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000000377
Family alpha-catenin/vinculin 0.047
Further Details:      
 
Domain Number 10 Region: 1615-1727
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000135
Family VBS domain 0.033
Further Details:      
 
Domain Number 11 Region: 79-136
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000162
Family First domain of FERM 0.036
Further Details:      
 
Domain Number 12 Region: 1926-2051
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000377
Family VBS domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009942019.1.35112
Sequence length 2333
Comment PREDICTED: LOW QUALITY PROTEIN: talin-1 [Opisthocomus hoazin]; AA=GCF_000692075.1; RF=representative genome; TAX=30419; STAX=30419; NAME=Opisthocomus hoazin; AL=Scaffold; RT=Major
Sequence
MVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERVPEAQMGQPNDFGLFLSDEDPKKGI
WLEAGKALDYYMLRNGDTMEYKKKQRPLKIRMLDGTVKTVMVDDSKTVTDMLMTICARIG
ITNYDEYSLVREIMEEKKEEVTGTLKKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGIDDNETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
YQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKEEGRAGRCVLADTFSLSM
LEDSVSPKKSTVLQQQFNRVGKAELGSVALPAIMRTGAGGPENFQVGTMPQPQLQITSGQ
MHRGHMPPLTSAQQALTGTINSSMQAVHAAQATLDDFETLPPLGQDAASKAWRKNKMDES
KHEIHSQVDAITAGTASVVNLTAGDPADTDYTAVGCAVTTISSNLTEMSKGVKLLAALME
DEGGNGRQLLQAAKNLASAVSDLLKTAQPASAEPRQNLLQAAGLVGQTSGELLQQIGESD
TDPRFQVVAPTISSPVCQEQLIEAGKLVAKSAEGCVEASKAATSDDQLLKQVGVAATAVT
QALNDLLQHIKQHALGGQPIGRYDQATDTILNVTENIFSSMGDAGEMVRQARILAQATSD
LVNAIKADAEGETDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAE
GLRMATNAAAQNAIKKKLVHKLEHAAKQAAASATQTIAAAQHAASSNKTSSXLVQSCKVV
AEQIPMLVQGVRGSQSQPDSPSAQLALIAASQNFLQPGGKMVAAAKATVPTITDQASAMQ
LSQCAKNLAAALAELRTAAQKAQEACGPLEIDSALGLVQSLERDLQEAKAAARDGKLKPL
PGETMEKCAQDLGNSTKAVSSAIAHLLGEVAQGNENYTGIAAREVAQALRSLSQAARGVA
ASTPDPQAQSAMLECASDVMDKGNNLLEAGLSSLGCSVAYPQACARPSSSVSILLAASAN
PSPCLQFPPSTKSFQEAQSQLNRAAAGLNQSANELVQASRGTPQDLAKSSGKFGQDFNEF
LQAGVEMASQSPNKEDQAQVVSNLKSISMSSSKLLLAAKALSADPAAPNLKNQLAAAARA
VTDSINQLITMCTQQAPGQKECDNALRELETVKELLENPTQTVNDMSYFNCLDSVMENSK
VLGESMAGISQNAKNSKLPEFGDSISAASKALCGLTEAAAQAAYLVGVSDPNSQAGQQGL
VDPTQFARANQAIQMACQNLVDPACTQSQVLSAATIVAKHTSALCNTCRLASSRTANPVA
KRQFVQSAKEVANSTANLVKTIKALDGEFNEENRERCRAATAPLIEAVDNLTAFASNPEF
ATVPAQISPEGRRAMEPIVSSAKTMLESSAGLIQTARSLAVNPKDPPQWSVLAGHSRTVS
DSIKKLITNMRDKAPGQRECDEAIEVLNRCMREVDQASLAAISQQLAPREDISQEALHNQ
MITAVQEISNLIEPVASAARAEASQLGHKVSQMAQYFEPLIMAAIGAASKTPNHQQQMNL
LDQTKTLAESALQMLYTAKEAGGNPKQAAHTQEALEEAVQMMKEAVEDLTTTLNEAASAA
GVVGGMVDSITQAINQLDEGPMGEPEGTFVDYQTTMVKTAKAIAVTVQEMVTKSTTNPDE
LGILANQLTNDYGQLAQEAKPAALTAENEEIGSHIKRRVQELGHGCAALVTKAGALQCSP
SDAYTKKELIESARKVSEKVSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIMFATA
GTLNRENSETFADHREGILKTAKALVEDTKVLVQNATASQEKLAQAAQSSVSTITRLAEV
VKLGAASLGSEDPETQVVLINAVKDVAKALGDLIGATKAAAGKAGDDPAVYQLKNSAKVM
VTNVTSLLKTVKAVEDEATKGTRALEATIEHIRQELAVYSRGAAAPVPPARVSTPEDFIR
MTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACKEAAYHPEVGGDVRQRAL
RFGKECADGYLELLEHVLVILQKPTHELKQQLAGYSKRVASSVTELIQAAEAMKGTEWVD
PEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKQADESLDFEEQILEAAKSIAAATS
ALVKAASAAQRELVAQGKVGAIPANAVDDGQWSQGLISAETEPGWEQQRLKWS
Download sequence
Identical sequences XP_009942019.1.35112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]