SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009956149.1.99599 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009956149.1.99599
Domain Number 1 Region: 488-653
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.83e-72
Family A middle domain of Talin 1 0.0000000609
Further Details:      
 
Domain Number 2 Region: 754-887
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.47e-49
Family I/LWEQ domain 0.000000839
Further Details:      
 
Domain Number 3 Region: 658-781
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.75e-47
Family I/LWEQ domain 0.00000155
Further Details:      
 
Domain Number 4 Region: 1835-1967
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.63e-45
Family VBS domain 0.00000125
Further Details:      
 
Domain Number 5 Region: 1224-1359
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.88e-38
Family VBS domain 0.012
Further Details:      
 
Domain Number 6 Region: 195-308
Classification Level Classification E-value
Superfamily Second domain of FERM 6.8e-35
Family Second domain of FERM 0.000000392
Further Details:      
 
Domain Number 7 Region: 309-399
Classification Level Classification E-value
Superfamily PH domain-like 2.71e-25
Family Third domain of FERM 0.00000822
Further Details:      
 
Domain Number 8 Region: 1073-1205
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.96e-24
Family VBS domain 0.027
Further Details:      
 
Domain Number 9 Region: 1464-1553
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000157
Family I/LWEQ domain 0.0084
Further Details:      
 
Domain Number 10 Region: 79-136
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000138
Family First domain of FERM 0.036
Further Details:      
 
Domain Number 11 Region: 1041-1066,1119-1203,1274-1313,1340-1375,1624-1813,2025-2088
Classification Level Classification E-value
Superfamily ARM repeat 0.0000023
Family Armadillo repeat 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009956149.1.99599
Sequence length 2114
Comment PREDICTED: LOW QUALITY PROTEIN: talin-1-like [Leptosomus discolor]; AA=GCF_000691785.1; RF=representative genome; TAX=188344; STAX=188344; NAME=Leptosomus discolor; AL=Scaffold; RT=Major
Sequence
MVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERVPEAQMGQPNDFGLFLSDEDPKKGI
WLEAGKALDYYMLRNGDTMEYKKKQRPLKIRMLDGTVKTVMVDDSKTVTDMLMTICARIG
ITNYDEYSLVREIMEEKKEEVTGTLKKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGIDDNETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
YQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPKKSTVLQQQFNRVGKAELGSVALPAIMRTGAGGPENFQVGTMPQPQLQITSGQM
HRGHMPPLTSAQQALTGTINSSMQAVHAAQATLDDFETLPPLGQDAASKAWRKNKMDESK
HEIHSQVDAITAGTASVVNLTAGDPADTDYTAVGCAVTTISSNLTEMSKGVKLLAALMED
EGGNGRQLLQAAKNLASAVSDLLKTAQPASAEPRQNLLQAAGLVGQTSGELLQQIGESDT
DPRFQDMLMQLAKAVASAAAALVLKAKNVAQKTEDSALQTQVIAAATQCALSTSQLVACT
KVVAPTISSPVCQEQLIEAGKLVAKSAEGCVEASKAATSDDQLXPVGGPATAVTQALNDL
LQHIKQHALGGQPIGRYDQATDTILNVTENIFSSMGDAGEMVRQARILAQATSDLVNAIK
ADAEGETDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMAT
NAAAQNAIKKKLVHKLEHAAKQAAASATQTIAAAQHAASSNKNPAAQQQLVQSCKVVAEQ
IPMLVQGVRGSQSQPDSPSAQLALIAASQNFLQPGGKMVAAAKATVPTITDQASAMQLSQ
CAKNLAAALAELRTAAQKAQEACGPLEIDSALGLVQSLERDLQEAKAAARDGKLKPLPGE
TMEKCAQDLGNSTKAVSSAIAHLLGEVAQGNENYTGIAAREVAQALRSLSQAARGVAAST
PDPQAQSAMLDCASDVMDKANNLIEEARKAVAKPGDPESQQRLAQVAKAVSQALSRCVNC
LPGQRDVDAAIRMVGEASKRLLADSFPPSAKSFQEAQSQLNRAAAGLNQSANELVQASRG
TPQDLAKSSGKFGQDFNEFLQAGVEMASQSPNKEDQAQVVSNLKSISMSSSKLLLAAKAL
SADPAAPNLKNQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVKELLENPTQ
TVNDMSYFNCLDSVMENSKVLGESMAGISQNAKNSKLPEFGDSISAASKALCGLTEAAAQ
AAYLVGVSDPNSQAGQQGLVDPTQFARANQAIQMACQNLVDPACTQSQVLSAATIVAKHT
SALCNTCRLASSRTANPVAKRQFVQSAKEVANSTANLVKTIKALDGEFNEENRERCRAAT
APLIEAVDNLTAFASNPEFATVPAQISPEGRRAMEPIVSSAKTMLESSAGLIQTARSLAV
NPKDPPQWSVLAGQSDSIKKLITNMRDKAPGQQECDEAIEVLNRCMREVDQASLAAISQQ
LAPREDISQEALHNQMITAVQEISNLIEPVASAARAEASQLGHKVSQMAQYFEPLIMAAV
GAASKTPNHQQQMNLLDQTKTLAESALQMLYTAKEAGGNPKQAAHTQEALEEAVQMMKEA
VEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGTFVDYQTTMVKTAKAIAV
TVQEMVTKSTTNPDELGILANQLTNDYGQLAQEAKPAALTAENEEIGSHIKRRVQELGHG
CAALVTKAGALQCSPSDAYTKKELIESARKVSEKVSHVLAALQAGNRGTQACITAASAVS
GIIADLDTTIMFATAGTLNRENSETFADHREGILKTAKALVEDTKVLVQNATASQEKLAQ
AAQSSVSTITRLAEVVKLGAASLGSEDPETQVVLINAVKDVAKALGDLIGATKAAAGKAG
DDPAVYQLKNSAKV
Download sequence
Identical sequences XP_009956149.1.99599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]