SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009969323.1.75343 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009969323.1.75343
Domain Number 1 Region: 435-656
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.89e-56
Family DBL homology domain (DH-domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 223-356
Classification Level Classification E-value
Superfamily BRCT domain 9.6e-22
Family DNA topoisomerase II binding protein 1, TopBP1 0.074
Further Details:      
 
Domain Number 3 Region: 138-250
Classification Level Classification E-value
Superfamily BRCT domain 5.32e-19
Family DNA ligase 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009969323.1.75343
Sequence length 921
Comment PREDICTED: protein ECT2 isoform X2 [Tyto alba]; AA=GCF_000687205.1; RF=representative genome; TAX=56313; STAX=56313; NAME=Tyto alba; AL=Scaffold; RT=Major
Sequence
MADNSTLVSETGRSLLADSSVLDSKIIETSKENVFPGSVLDVEEEMPQIETRVVLVQEAG
KCEELLKALETIKIMEVPVIKIKETSPGKSEEKLIKSIIQMEIKVPYIKTDTIEELGDSD
SPEFESIFVVSDFQDSIFNNLCKADCRVIGPPVVLHCAQKGEPLPFSCRPLYCASMLNLV
LCFTGFRKKDELVKLVTLVHHMGGIIRRDFSSKVTHLVANSTHGDKFRIAVSLGTPILKS
EWIYKAWEKRNEIDFCAADDDFRNQFKVPPFQDCMLSFLGFSDDEKANMEEMTEMQGGHY
LPVGDERCTHLVVEESTVKDLPFEPLKNLYVVKQEWFWGSIQMDARAGESMYLFEKSESP
GLKKSVSLLSLSTPNSNRKRRRLKETLAQLTRETDMSPFPPRKRPSAEHSLSIGSLLDIS
NTPESSSTNGETPKSCARPSKNSTPLPLKQSARWQVAKELYQTESNYVDILTTIIQLFQV
PLEKEGQLGGPILAQEEIKTIFGSIPDILDVHTKIKEDLEDLMMNWTESKSIGDIILKYS
KDLLKTYPPFVNFFEMSKETITRCEKQKPRFHAFLKINQAKPECGRQSLAELLIRPVQRL
PSVALLLNDIKKHTAEENPDKITLERAIESLKEVMTHINEDKRKTEAQRQFFDVVYEVDG
CPANLLSSHRSLVQRLETVALGDDLCDRGEXXXXXXXXXXXFLFNDCLEIARKRHKVIGV
FKSPHGHTRPPASLKHVVLMPLSQIKKVLDIRETEDCHKAFALVVRPPTELNNKLLSFQM
TAEEPPKEDWLKMLCRHVANTICKADAENLIYTTDPDSVEVNTKDMDSTLSKASRAIKKT
SKKVTRAFSFSKTPKRALRRALMSHSATEGRSPSSANESYIGSRLTSTSSLAGIPSPSLV
SLPSIFEKRSHTLSRSTTHLI
Download sequence
Identical sequences XP_009969323.1.75343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]