SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010054965.1.83385 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010054965.1.83385
Domain Number 1 Region: 24-204
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.57e-69
Family Inorganic pyrophosphatase 0.0000037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010054965.1.83385
Sequence length 208
Comment PREDICTED: soluble inorganic pyrophosphatase 1 [Eucalyptus grandis]; AA=GCF_000612305.1; RF=representative genome; TAX=71139; STAX=71139; NAME=Eucalyptus grandis; cultivar=BRASUZ1; AL=Scaffold; RT=Major
Sequence
MSEVDGSHRPVPRLNERILSSLSRRSVAAHPWHDLEIGPEAPQIVNCVVEITKGSKVKYE
LDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPIDVLVLMQEPVVPGCFLRARAIG
LMPMIDQGEKDDKIIAVCADDPEYKHYTDIKQLPPHRLSEIRRFFEDYKKNENKEVAVND
FLPSSTATEAIQYSMDLYAEYILHTLRR
Download sequence
Identical sequences A0A059C0M9
XP_010054965.1.83385 Eucgr.E00014.1|PACid:23576638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]